DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and Prmt1

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_062804.1 Gene:Prmt1 / 15469 MGIID:107846 Length:371 Species:Mus musculus


Alignment Length:374 Identity:152/374 - (40%)
Similarity:215/374 - (57%) Gaps:40/374 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 DGAPTQPSVLELQQRIAEQSQLLQQANEDMERMRNDYKALLQKVHADGEPKGSDQSVPRNNVCLD 205
            :|...||.:.|:....||.|:  :...|||  ...||                            
Mouse    20 NGMSLQPPLEEVSCGQAESSE--KPNAEDM--TSKDY---------------------------- 52

  Fly   206 NEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARVV 270
              ||.||||||||.|||.|:|||.|||.|:..|..:.:.|.|||||.|||||.:||:||||.:|:
Mouse    53 --YFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVI 115

  Fly   271 GIDNSDIVYTAMDIIRKNKVEN-VELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIYA 334
            ||:.|.|...|:.|::.||::: |.:|||::|:.:||..|.||||||||||.|.|||||:::::|
Mouse   116 GIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHA 180

  Fly   335 RENHLNPNGIILPSRCTLSLLGYGDDTLYAD-EVEFWSNVYEVDMSDLRKQSIEEPLMQVVDAEF 398
            |:..|.|:|:|.|.|.||.:... :|..|.| ::.:|.|||..|||.::..:|:|||:.|||.:.
Mouse   181 RDKWLAPDGLIFPDRATLYVTAI-EDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQ 244

  Fly   399 MLTEPEQIANFDIMTVDMNYPNFTHQFSLKVTKPGRLSAFVGYFETLF-ELPSPVMFSTSPSATP 462
            ::|....|...||.||.:....||..|.|:|.:...:.|.|.||...| .......|||||.:..
Mouse   245 LVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPY 309

  Fly   463 THWKQTVFFIENPQVVKEGDVICGKITSRRHKEDVRGL--SVDIEVFGK 509
            ||||||||::|:...||.|:.|.|.|..|.:.::.|.|  ::|::..|:
Mouse   310 THWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 55/103 (53%)
Prmt1NP_062804.1 AdoMet_MTases 92..192 CDD:100107 54/99 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.