DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and Prmt2

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001289894.1 Gene:Prmt2 / 15468 MGIID:1316652 Length:475 Species:Mus musculus


Alignment Length:431 Identity:131/431 - (30%)
Similarity:212/431 - (49%) Gaps:74/431 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LKTDGAPTQPSVLELQQR----IAEQSQLLQQANED--MERMRNDYKALLQKVHAD---GEPKGS 193
            |..|||..|   |:||..    ||:.:     |.::  :..:|.:...:|::..||   ||..|.
Mouse    31 LLQDGAQLQ---LQLQPEEFVAIADYT-----ATDETQLSFLRGEKILILRQTTADWWWGERAGC 87

  Fly   194 DQSVPRNNV------------CLDNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKT 246
            ...:|.|::            ..|.|||.||....:|.|||:|:.||:.|.:.:|||:..::.|.
Mouse    88 CGYIPANHLGKQLEEYDPEDTWQDEEYFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKV 152

  Fly   247 VLDVGCGTGILSIF-ASKAGAARVVGIDNSDIV-YTAMDIIRKNKVENVELIKGRLEDTDLPETK 309
            :|||||||||:|:| |..|....|..::.||:. :|:..:::....:.:.:.:.::||..||| |
Mouse   153 ILDVGCGTGIISLFCAHHARPKAVYAVEASDMAQHTSQLVLQNGFADTITVFQQKVEDVVLPE-K 216

  Fly   310 YDIIISEWMGYFLLYESMLDSIIYARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVEFWSNVY 374
            .|:::|||||..||:|.|::||:|||:..|..:|||.|:...|.|:....:..|..:|.||.|.|
Mouse   217 VDVLVSEWMGTCLLFEFMIESILYARDTWLKGDGIIWPTTAALHLVPCSAEKDYHSKVLFWDNAY 281

  Fly   375 EVDMSDLRKQSIEEPLMQ-----VVDAEFMLTEPEQIANFDIMTVDM-NYPNFTHQFSLKVTKPG 433
            |.::|.|:..:|:|...:     ::..|..|:||..|...|:.||.: :......:....:.|.|
Mouse   282 EFNLSALKSLAIKEFFSRPKSNHILKPEDCLSEPCTILQLDMRTVQVPDLETMRGELRFDIQKAG 346

  Fly   434 RLSAFVGYFETLFE-----LPSPVMFSTSP------------------------------SATPT 463
            .|..|..:|...|:     .|..|: ||.|                              |.:.|
Mouse   347 TLHGFTAWFSVYFQSLEEGQPQQVL-STGPLHPFLGRTGCQCRGPRWSCQMRPVGDRMLLSCSTT 410

  Fly   464 HWKQTVFFIENPQVVKEGDVICGKITSRRHKEDVRGLSVDI 504
            |||||:|.:::|..|..|||:.|.:..:|:....|.:||.:
Mouse   411 HWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVSL 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 42/104 (40%)
Prmt2NP_001289894.1 SH3_PRMT2 46..98 CDD:212740 12/56 (21%)
AdoMet_MTases 122..>181 CDD:302624 26/58 (45%)
AdoMet_MTases 153..253 CDD:100107 41/100 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.