powered by:
Protein Alignment Art3 and ATPSCKMT
DIOPT Version :9
Sequence 1: | NP_650434.1 |
Gene: | Art3 / 41837 |
FlyBaseID: | FBgn0038306 |
Length: | 516 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_954584.2 |
Gene: | ATPSCKMT / 134145 |
HGNCID: | 27029 |
Length: | 233 |
Species: | Homo sapiens |
Alignment Length: | 42 |
Identity: | 15/42 - (35%) |
Similarity: | 22/42 - (52%) |
Gaps: | 5/42 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 233 ASLLQNEAVV-----RGKTVLDVGCGTGILSIFASKAGAARV 269
|:..|.|.|| |..:::|:|.|.|.:.|.|:|.|...|
Human 73 ATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAV 114
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.