DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and CARM1

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_954592.1 Gene:CARM1 / 10498 HGNCID:23393 Length:608 Species:Homo sapiens


Alignment Length:414 Identity:110/414 - (26%)
Similarity:191/414 - (46%) Gaps:84/414 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KYLQPGEYEPWLCYDYEVLKT-DGAPTQPSVLELQQRIAEQSQLLQQANEDMERMRNDYKALLQK 183
            ::..|.::    |..|.:||| .|...:.||  ..:|..|.|.:                     
Human   110 QFATPNDF----CSFYNILKTCRGHTLERSV--FSERTEESSAV--------------------- 147

  Fly   184 VHADGEPKGSDQSVPRNNVCLDNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVL 248
                                   :||:.|.:......|:.|.|||.||:.::|||....:.|.||
Human   148 -----------------------QYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVL 189

  Fly   249 DVGCGTGILSIFASKAGAARVVGIDNSDIVYTAMDIIRKNKV-ENVELIKGRLEDTDLPETKYDI 312
            |||||:||||.||::|||.::..::.|.:...|..:::.|.: :.:.:|.|::|:..||| :.||
Human   190 DVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPE-QVDI 253

  Fly   313 IISEWMGYFLLYESMLDSIIYARENHLNPNGIILPSRCTLSLLGYGDDTLYADE---VEFW--SN 372
            ||||.|||.|..|.||:|.::|:: :|.|:|.:.|:...:.|..:.|:.||.::   ..||  .:
Human   254 IISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPS 317

  Fly   373 VYEVDMSDLRKQSIEE----PLMQVVDAEFMLTEP-EQIANF------DIMTVDMNYPNFTHQFS 426
            .:.||:|.||..:::|    |::...|...::.:. :...||      |:..:::       .|.
Human   318 FHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEI-------PFK 375

  Fly   427 LKVTKPGRLSAFVGYFETLFELPS--PVMFSTSPSATPTHWKQTVFFIENPQVVKEGDVICGK-- 487
            ..:...|.:.....:|:..| :.|  .|..||:|:...|||.|.....::|...|.||.:.|.  
Human   376 FHMLHSGLVHGLAFWFDVAF-IGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCL 439

  Fly   488 -ITSRRHKEDVRGLSVDIEVFGKK 510
             |.::|...|: .:...::..|.|
Human   440 LIANKRQSYDI-SIVAQVDQTGSK 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 44/103 (43%)
CARM1NP_954592.1 CARM1 34..138 CDD:288395 9/33 (27%)
PRMT5 <172..435 CDD:282971 83/272 (31%)
Methyltransf_18 184..283 CDD:289607 43/100 (43%)
Transactivation domain. /evidence=ECO:0000250 499..608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.