DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and prmt6

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001120104.1 Gene:prmt6 / 100145123 XenbaseID:XB-GENE-5857258 Length:340 Species:Xenopus tropicalis


Alignment Length:297 Identity:110/297 - (37%)
Similarity:167/297 - (56%) Gaps:16/297 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 DNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARV 269
            |.|||:.|:...:|.||::|.|||:.|:.:||:|.:.::||||||||.||||||:|:.:|||..|
 Frog    15 DCEYFQCYSDVSVHEEMIADTVRTNAYKLALLRNHSSLQGKTVLDVGAGTGILSVFSVQAGAQAV 79

  Fly   270 VGIDNSDIVYTAMDIIRKNKVEN-VELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIY 333
            ..::.|.:...|..:::.|.:|| |:::...:|..::|| :.|.|:||||||.|:|||||.|:||
 Frog    80 YAVEASSMSQLACQVVKSNDMENKVKVLNSSVESAEIPE-QVDAIVSEWMGYALMYESMLPSVIY 143

  Fly   334 ARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVEFWSNV---YEVDMSDLRKQSIEEPLMQVVD 395
            ||:..|.|.|:|||| |....:...:|.:....::|||.|   |.||||.:  ||.....:...:
 Frog   144 ARDKWLKPGGLILPS-CADLFIAPVNDLIVESRLDFWSEVKGMYGVDMSCM--QSFARSCIMNKE 205

  Fly   396 AEFMLTEPEQIANFDI--MTVDMN------YPNFTHQFSLKVTKPGRLSAFVGYFETLFELPSPV 452
            ....|..||.:.:|.:  .::|:|      ..|....|.........|..|..:|...|...:.|
 Frog   206 MAVNLVSPEDVLSFPVRFASLDLNVCTQEEVRNLHGSFQFSCFGSSLLHGFAVWFSVTFPGENSV 270

  Fly   453 MFSTSPSATPTHWKQTVFFIENPQVVKEGDVICGKIT 489
            ..||||....||||||:.:::....|::...|.|.:|
 Frog   271 TLSTSPYGEETHWKQTLLYLDEEVQVEQDTEITGDVT 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 50/103 (49%)
prmt6NP_001120104.1 AdoMet_MTases 56..156 CDD:100107 48/100 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.