DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and zgc:194242

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001122287.1 Gene:zgc:194242 / 100005854 ZFINID:ZDB-GENE-081022-84 Length:210 Species:Danio rerio


Alignment Length:174 Identity:30/174 - (17%)
Similarity:62/174 - (35%) Gaps:56/174 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 LDNEYFKSYAH-------------FGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTG 255
            |.|:..|...|             |..|:::|.:       .|..|.|  :....|||::..|.|
Zfish     2 LPNQVGKQLGHPTYSLSGWLVSKFFKWHNQVLEE-------NAVKLCN--IEPNNTVLELCHGPG 57

  Fly   256 ILSIFASK---AGAARVVGIDNSDIVYTAMDIIRKNKVENVELIKGRLEDTDLPETKYDIIISEW 317
            ....:||:   ....::.|:|:|..::              |:...|::: .:...|.::..|:.
Zfish    58 FGLHYASQLLTGPEGKLFGVDHSQYMH--------------EMASKRMKE-QISRGKVELYCSDL 107

  Fly   318 MGYFLLYESMLDSIIYAR---------------ENHLNPNGIIL 346
            |. ..:.|:.:|.:.:..               ...:.|.||::
Zfish   108 MA-MPIEENTVDKVFHCNCYYFWPDMKAGASVIHRVMKPGGIMV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 20/120 (17%)
zgc:194242NP_001122287.1 Methyltransf_11 55..150 CDD:285453 17/110 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.