DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and si:ch211-93g23.2

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001139099.1 Gene:si:ch211-93g23.2 / 100005086 ZFINID:ZDB-GENE-090312-164 Length:274 Species:Danio rerio


Alignment Length:340 Identity:70/340 - (20%)
Similarity:111/340 - (32%) Gaps:105/340 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 HADGEPKGSDQSVPRNNVCLDNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLD 249
            |.:|  |...:|..|:.|....|......:|      |..::.|....|              :|
Zfish     5 HFEG--KDHVESYQRHRVSPPQELIDEVLNF------LRKRINTDLDLA--------------VD 47

  Fly   250 VGCGTG-----ILSIFASKAGAARVVGIDNSDI-VYTAMDIIRKNKVENVELIKGRLEDTDLPET 308
            ||||:|     :...|.:      |||.|.|.. :..|.|   |:...|:...:...||....::
Zfish    48 VGCGSGQGTELLAPYFLT------VVGTDISPAQLKIASD---KDHPANICYRESPAEDLPFEDS 103

  Fly   309 KYDIIISEWMGYFLLYESMLDSIIYARENHLNPNGIILPSRCTLSL-LGYGDDTLYADEV--EFW 370
            ..|::.|....::..:...|..:    :..|.|.|.:.....|:.. |.||:.|...:.:  ||:
Zfish   104 IADLVSSMSAAHWFDHPRFLQEV----DRILKPGGCLALLSYTMDFELEYGESTSKLNNICEEFY 164

  Fly   371 SNVYEVDMSDLRKQSIEEPLMQVVDAEFMLTEPEQIANFDIMTVDMNYPNFTHQFS--------- 426
            :.::     ..||..|....:||                        |.|.....|         
Zfish   165 AALH-----PFRKAYIGSSSLQV------------------------YKNIYDSISYADKEWHEC 200

  Fly   427 LKVTKPGRLSAFVGYFETLFELPSPVMFSTSPSATPTHWKQTVFFIENPQVVKEGDVICGKITSR 491
            ||..:...||.|:|..||         |||...          |..::|...|:    ..|..:.
Zfish   201 LKSRRIMPLSKFIGLVET---------FSTYQG----------FLEKDPVKAKK----LSKTITD 242

  Fly   492 RHKEDVRGLSVDIEV 506
            |..|.:...|.|.|:
Zfish   243 RLLEAMGASSTDTEL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 24/108 (22%)
si:ch211-93g23.2NP_001139099.1 SmtA 1..240 CDD:223574 65/321 (20%)
Methyltransf_11 46..138 CDD:285453 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.