DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caf1-55 and WDR59

DIOPT Version :9

Sequence 1:NP_524354.1 Gene:Caf1-55 / 41836 FlyBaseID:FBgn0263979 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_005256203.1 Gene:WDR59 / 79726 HGNCID:25706 Length:993 Species:Homo sapiens


Alignment Length:261 Identity:64/261 - (24%)
Similarity:97/261 - (37%) Gaps:75/261 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 SGECQPDLRLRGHQKEGYGLSW---NPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTG 229
            |||.  ...|:||.:....|.|   .|:|   |:::|.|..|.:|||..|.|....:.|      
Human    94 SGEV--GTTLQGHTRVISDLDWAVFEPDL---LVTSSVDTYIYIWDIKDTRKPTVALSA------ 147

  Fly   230 HTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVD---AHTAEVNCLSFNPYSEF 291
             .|....|.|:..:.:.. :.:.|..:.|||.|     |||..|:   ||.::::.|.::|.||.
Human   148 -VAGASQVKWNKKNANCL-ATSHDGDVRIWDKR-----KPSTAVEYLAAHLSKIHGLDWHPDSEH 205

  Fly   292 ILATGSADKTVALWDLR-----------------------------------------------N 309
            ||||.|.|.:|..||.|                                               :
Human   206 ILATSSQDNSVKFWDYRQPRKYLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNVFD 270

  Fly   310 LKLKLHSFESHKDEIFQVQWSPHNETI----LASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPEL 370
            |...:|:|..|.|.:.:.||....|..    |.:...|:.|.:|.:....:.....|..||..|.
Human   271 LNTPVHTFVGHDDVVLEFQWRKQKEGSKDYQLVTWSRDQTLRMWRVDSQMQRLCANDILDGVDEF 335

  Fly   371 L 371
            :
Human   336 I 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Caf1-55NP_524354.1 CAF1C_H4-bd 23..92 CDD:403473
WD40 127..408 CDD:421866 64/261 (25%)
WD40 repeat 132..179 CDD:293791 4/10 (40%)
WD40 repeat 184..228 CDD:293791 14/46 (30%)
WD40 repeat 235..274 CDD:293791 10/38 (26%)
WD40 repeat 280..318 CDD:293791 16/84 (19%)
WD40 repeat 324..375 CDD:293791 11/52 (21%)
WD40 repeat 381..406 CDD:293791
WDR59XP_005256203.1 WD40 <34..328 CDD:225201 60/251 (24%)
WD40 repeat 62..103 CDD:293791 4/10 (40%)
WD40 100..>343 CDD:295369 61/253 (24%)
WD40 repeat 109..150 CDD:293791 14/50 (28%)
WD40 repeat 154..188 CDD:293791 11/39 (28%)
WD40 repeat 195..229 CDD:293791 14/33 (42%)
WD40 repeat 237..279 CDD:293791 2/41 (5%)
WD40 repeat 285..316 CDD:293791 7/30 (23%)
RWD 394..494 CDD:214735
Zn_ribbon_17 943..991 CDD:305234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0264
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.