Sequence 1: | NP_524354.1 | Gene: | Caf1-55 / 41836 | FlyBaseID: | FBgn0263979 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005256203.1 | Gene: | WDR59 / 79726 | HGNCID: | 25706 | Length: | 993 | Species: | Homo sapiens |
Alignment Length: | 261 | Identity: | 64/261 - (24%) |
---|---|---|---|
Similarity: | 97/261 - (37%) | Gaps: | 75/261 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 168 SGECQPDLRLRGHQKEGYGLSW---NPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTG 229
Fly 230 HTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVD---AHTAEVNCLSFNPYSEF 291
Fly 292 ILATGSADKTVALWDLR-----------------------------------------------N 309
Fly 310 LKLKLHSFESHKDEIFQVQWSPHNETI----LASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPEL 370
Fly 371 L 371 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Caf1-55 | NP_524354.1 | CAF1C_H4-bd | 23..92 | CDD:403473 | |
WD40 | 127..408 | CDD:421866 | 64/261 (25%) | ||
WD40 repeat | 132..179 | CDD:293791 | 4/10 (40%) | ||
WD40 repeat | 184..228 | CDD:293791 | 14/46 (30%) | ||
WD40 repeat | 235..274 | CDD:293791 | 10/38 (26%) | ||
WD40 repeat | 280..318 | CDD:293791 | 16/84 (19%) | ||
WD40 repeat | 324..375 | CDD:293791 | 11/52 (21%) | ||
WD40 repeat | 381..406 | CDD:293791 | |||
WDR59 | XP_005256203.1 | WD40 | <34..328 | CDD:225201 | 60/251 (24%) |
WD40 repeat | 62..103 | CDD:293791 | 4/10 (40%) | ||
WD40 | 100..>343 | CDD:295369 | 61/253 (24%) | ||
WD40 repeat | 109..150 | CDD:293791 | 14/50 (28%) | ||
WD40 repeat | 154..188 | CDD:293791 | 11/39 (28%) | ||
WD40 repeat | 195..229 | CDD:293791 | 14/33 (42%) | ||
WD40 repeat | 237..279 | CDD:293791 | 2/41 (5%) | ||
WD40 repeat | 285..316 | CDD:293791 | 7/30 (23%) | ||
RWD | 394..494 | CDD:214735 | |||
Zn_ribbon_17 | 943..991 | CDD:305234 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0264 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |