| Sequence 1: | NP_524354.1 | Gene: | Caf1-55 / 41836 | FlyBaseID: | FBgn0263979 | Length: | 430 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_077321.3 | Gene: | DCAF10 / 79269 | HGNCID: | 23686 | Length: | 559 | Species: | Homo sapiens |
| Alignment Length: | 262 | Identity: | 66/262 - (25%) |
|---|---|---|---|
| Similarity: | 102/262 - (38%) | Gaps: | 66/262 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 138 PQNACVIATKTPSSDVLVFDYTKHPSKP--EPSGECQ---------------PDLRLRGHQKE-- 183
Fly 184 -GYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLF 247
Fly 248 GSV----ADDQKLMIWDTRNNNTSKPSHTV-DAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 307
Fly 308 RNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLF 372
Fly 373 IH 374 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Caf1-55 | NP_524354.1 | CAF1C_H4-bd | 23..92 | CDD:403473 | |
| WD40 | 127..408 | CDD:421866 | 66/262 (25%) | ||
| WD40 repeat | 132..179 | CDD:293791 | 12/57 (21%) | ||
| WD40 repeat | 184..228 | CDD:293791 | 7/43 (16%) | ||
| WD40 repeat | 235..274 | CDD:293791 | 9/43 (21%) | ||
| WD40 repeat | 280..318 | CDD:293791 | 16/37 (43%) | ||
| WD40 repeat | 324..375 | CDD:293791 | 13/51 (25%) | ||
| WD40 repeat | 381..406 | CDD:293791 | |||
| DCAF10 | NP_077321.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..119 | 9/51 (18%) | |
| WD40 | <164..319 | CDD:295369 | 44/158 (28%) | ||
| WD 1 | 166..205 | 11/51 (22%) | |||
| WD40 | <171..>334 | CDD:225201 | 42/147 (29%) | ||
| WD40 repeat | 172..207 | CDD:293791 | 9/43 (21%) | ||
| WD 2 | 209..247 | 18/39 (46%) | |||
| WD40 repeat | 214..250 | CDD:293791 | 16/37 (43%) | ||
| WD 3 | 251..290 | 10/47 (21%) | |||
| WD40 repeat | 256..282 | CDD:293791 | 6/26 (23%) | ||
| WD 4 | 296..335 | 1/2 (50%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 350..396 | ||||
| WD 5 | 408..448 | ||||
| WD 6 | 470..508 | ||||
| WD40 | 517..555 | CDD:197651 | |||
| WD 7 | 526..559 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0264 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||