DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Caf1-55 and Wdr24

DIOPT Version :9

Sequence 1:NP_524354.1 Gene:Caf1-55 / 41836 FlyBaseID:FBgn0263979 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_733303.2 Gene:Wdr24 / 43505 FlyBaseID:FBgn0027518 Length:777 Species:Drosophila melanogaster


Alignment Length:260 Identity:57/260 - (21%)
Similarity:114/260 - (43%) Gaps:37/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 LRG-HQKEGYG---LSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDV 237
            :|| :|...|.   ::|:...:..|.:|:.:..:.:||::...::.:::    ::..|......|
  Fly    57 MRGKNQNLSYSANDVAWSTLDSNLLATAATNGVVSVWDLSKFGRQKQLL----VYNEHERTAHTV 117

  Fly   238 AWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTV 302
            .:|....::..|.:.|..:..:|.|::   |..:|...::..|..:.|:|:::.|.:..|.:.||
  Fly   118 TFHSSEPNILISGSQDGTIKCFDIRSD---KSINTYFCNSESVRDVKFSPHTQNIFSAVSENGTV 179

  Fly   303 ALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGP 367
            .|||:|.....:..|.:|...::...|.| ....||:...|:::.||::             ||.
  Fly   180 QLWDMRKWDKCMVQFTAHYGPVYTCDWHP-TRNWLATGSRDKQIKVWNM-------------DGR 230

  Fly   368 PELLFIHGGHT-AKISDFSWNPNEPWII--CSVSEDNIMQVWQMAENVYNDEEPEIPASELETNT 429
            |.|  .|..|| |.:....|.|...:.|  |::..|..:.||.:       ..|.||.:....:|
  Fly   231 PGL--EHTIHTIAVVGRVKWRPERTYHIASCALVVDYSVHVWDI-------RRPYIPFASFNEHT 286

  Fly   430  429
              Fly   287  286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Caf1-55NP_524354.1 CAF1C_H4-bd 23..92 CDD:403473
WD40 127..408 CDD:421866 53/237 (22%)
WD40 repeat 132..179 CDD:293791 0/1 (0%)
WD40 repeat 184..228 CDD:293791 6/46 (13%)
WD40 repeat 235..274 CDD:293791 8/38 (21%)
WD40 repeat 280..318 CDD:293791 11/37 (30%)
WD40 repeat 324..375 CDD:293791 11/50 (22%)
WD40 repeat 381..406 CDD:293791 5/26 (19%)
Wdr24NP_733303.2 WD40 13..311 CDD:238121 57/260 (22%)
WD40 22..>312 CDD:225201 57/260 (22%)
WD40 repeat 70..109 CDD:293791 5/42 (12%)
WD40 repeat 115..152 CDD:293791 8/39 (21%)
WD40 repeat 157..194 CDD:293791 11/36 (31%)
WD40 repeat 202..236 CDD:293791 11/49 (22%)
WD40 repeat 243..283 CDD:293791 10/46 (22%)
Zn_ribbon_17 <720..777 CDD:305234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.