Sequence 1: | NP_524354.1 | Gene: | Caf1-55 / 41836 | FlyBaseID: | FBgn0263979 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998111.2 | Gene: | wdr32 / 405882 | ZFINID: | ZDB-GENE-040426-2314 | Length: | 508 | Species: | Danio rerio |
Alignment Length: | 242 | Identity: | 62/242 - (25%) |
---|---|---|---|
Similarity: | 95/242 - (39%) | Gaps: | 52/242 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 162 PSKPEPSGEC-------QPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATP---- 215
Fly 216 -KEH------------RVIDAKNIFT-GHTAVVEDVAWHLLHESLFGSV----ADDQKLMIWDTR 262
Fly 263 NNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQV 327
Fly 328 QWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIH 374 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Caf1-55 | NP_524354.1 | CAF1C_H4-bd | 23..92 | CDD:403473 | |
WD40 | 127..408 | CDD:421866 | 62/242 (26%) | ||
WD40 repeat | 132..179 | CDD:293791 | 5/23 (22%) | ||
WD40 repeat | 184..228 | CDD:293791 | 11/60 (18%) | ||
WD40 repeat | 235..274 | CDD:293791 | 7/42 (17%) | ||
WD40 repeat | 280..318 | CDD:293791 | 17/37 (46%) | ||
WD40 repeat | 324..375 | CDD:293791 | 13/51 (25%) | ||
WD40 repeat | 381..406 | CDD:293791 | |||
wdr32 | NP_998111.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..75 | 8/39 (21%) | |
WD 1 | 126..165 | 9/44 (20%) | |||
WD40 | <129..279 | CDD:295369 | 43/148 (29%) | ||
WD40 | <131..>294 | CDD:225201 | 42/146 (29%) | ||
WD40 repeat | 132..167 | CDD:293791 | 7/42 (17%) | ||
WD 2 | 169..207 | 18/39 (46%) | |||
WD40 repeat | 174..210 | CDD:293791 | 17/37 (46%) | ||
WD 3 | 211..250 | 10/47 (21%) | |||
WD40 repeat | 216..242 | CDD:293791 | 6/26 (23%) | ||
WD 4 | 256..295 | 1/2 (50%) | |||
WD40 repeat | 261..288 | CDD:293791 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 307..343 | ||||
WD 5 | 356..396 | ||||
WD 6 | 419..457 | ||||
WD 7 | 475..508 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0264 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |