DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31344 and RPC25

DIOPT Version :9

Sequence 1:NP_650433.1 Gene:CG31344 / 41835 FlyBaseID:FBgn0051344 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_012778.1 Gene:RPC25 / 853713 SGDID:S000001627 Length:212 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:32/151 - (21%)
Similarity:57/151 - (37%) Gaps:34/151 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 QDFLEATTHMWR---------VLGYLLGIKDEYNICGRNWAESKLR-------LDIVMRK-VYEP 258
            :|.:.|.||...         .:|..:.|.|...:     .|.:|:       :::..|. |::|
Yeast    20 RDTISAITHQLNNKFANKIIPNVGLCITIYDLLTV-----EEGQLKPGDGSSYINVTFRAVVFKP 79

  Fly   259 ALAN--TGEDFKRMTEALINGLWHINTMLSVNANIFFAKRLACVKGYEYYSFDHENGV-AQDPQQ 320
            .|..  ||...|...|.:...|..|...:.:..|:.|.   .|     ||:.:....: ..|.:.
Yeast    80 FLGEIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFE---GC-----YYTPEESAWIWPMDEET 136

  Fly   321 KLHYYDMGWWDRFIVSYGLFL 341
            || |:|:....||.:...:|:
Yeast   137 KL-YFDVNEKIRFRIEREVFV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31344NP_650433.1 DUF2236 100..>233 CDD:287016 6/30 (20%)
RPC25NP_012778.1 rpoE 1..184 CDD:129540 32/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.