DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31344 and RPB7

DIOPT Version :10

Sequence 1:NP_650433.1 Gene:CG31344 / 41835 FlyBaseID:FBgn0051344 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_010692.3 Gene:RPB7 / 852013 SGDID:S000002812 Length:171 Species:Saccharomyces cerevisiae


Alignment Length:56 Identity:12/56 - (21%)
Similarity:18/56 - (32%) Gaps:32/56 - (57%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQVDGCTSSSSEIPHPAKRETWISGKMQSSSHSKDGHNAAGASKLLQDHQEPEDYL 56
            ::::||.|..|.|                        :|.|:.|        ||||
Yeast   145 VKIEGCISQVSSI------------------------HAIGSIK--------EDYL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31344NP_650433.1 None
RPB7NP_010692.3 PTZ00162 1..171 CDD:240298 12/56 (21%)

Return to query results.
Submit another query.