DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31344 and POLR2G

DIOPT Version :9

Sequence 1:NP_650433.1 Gene:CG31344 / 41835 FlyBaseID:FBgn0051344 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_002687.1 Gene:POLR2G / 5436 HGNCID:9194 Length:172 Species:Homo sapiens


Alignment Length:53 Identity:13/53 - (24%)
Similarity:26/53 - (49%) Gaps:4/53 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 IVSYGLFLVTYLHRY-ALVRWYLNFRVWLVDIFTYYLPYVAIW-KFGPKSAYV 384
            ::..|...|.|..:| |:|  :..|:..:||.....:..|.:: :.||.|.::
Human    58 VIQPGRGFVLYPVKYKAIV--FRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFI 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31344NP_650433.1 DUF2236 100..>233 CDD:287016
POLR2GNP_002687.1 PTZ00162 1..169 CDD:240298 13/53 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.