DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31344 and POLR2G

DIOPT Version :10

Sequence 1:NP_650433.1 Gene:CG31344 / 41835 FlyBaseID:FBgn0051344 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_002687.1 Gene:POLR2G / 5436 HGNCID:9194 Length:172 Species:Homo sapiens


Alignment Length:53 Identity:13/53 - (24%)
Similarity:26/53 - (49%) Gaps:4/53 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 IVSYGLFLVTYLHRY-ALVRWYLNFRVWLVDIFTYYLPYVAIW-KFGPKSAYV 384
            ::..|...|.|..:| |:|  :..|:..:||.....:..|.:: :.||.|.::
Human    58 VIQPGRGFVLYPVKYKAIV--FRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFI 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31344NP_650433.1 None
POLR2GNP_002687.1 PTZ00162 1..169 CDD:240298 13/53 (25%)

Return to query results.
Submit another query.