powered by:
Protein Alignment CG31344 and POLR2G
DIOPT Version :9
Sequence 1: | NP_650433.1 |
Gene: | CG31344 / 41835 |
FlyBaseID: | FBgn0051344 |
Length: | 403 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_002687.1 |
Gene: | POLR2G / 5436 |
HGNCID: | 9194 |
Length: | 172 |
Species: | Homo sapiens |
Alignment Length: | 53 |
Identity: | 13/53 - (24%) |
Similarity: | 26/53 - (49%) |
Gaps: | 4/53 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 334 IVSYGLFLVTYLHRY-ALVRWYLNFRVWLVDIFTYYLPYVAIW-KFGPKSAYV 384
::..|...|.|..:| |:| :..|:..:||.....:..|.:: :.||.|.::
Human 58 VIQPGRGFVLYPVKYKAIV--FRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFI 108
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31344 | NP_650433.1 |
DUF2236 |
100..>233 |
CDD:287016 |
|
POLR2G | NP_002687.1 |
PTZ00162 |
1..169 |
CDD:240298 |
13/53 (25%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1095 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.