DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31344 and rpb-7

DIOPT Version :9

Sequence 1:NP_650433.1 Gene:CG31344 / 41835 FlyBaseID:FBgn0051344 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_491093.1 Gene:rpb-7 / 171877 WormBaseID:WBGene00021845 Length:197 Species:Caenorhabditis elegans


Alignment Length:193 Identity:41/193 - (21%)
Similarity:62/193 - (32%) Gaps:85/193 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 WHINTMLSVNANIFFAKRLACVKGYEYYSFDHENGVAQDPQQ---------KLHYYD------MG 328
            ||....|::  .:||           :.|.|||  |...|:.         |:..::      .|
 Worm    14 WHATGALTL--RMFF-----------HLSLDHE--VCLHPKYFGPNLNETIKMKLFNEVEGTCTG 63

  Fly   329 WWDRFI-------VSYGLF-----LVTYLHRY-ALVRWYLNFRVWLVDIFTYYLPYVAIW-KFGP 379
            .:...|       :.:||.     .|.|..|| |:|  :..|:..:||.....:..|.|: ..||
 Worm    64 KYGFVIAVTTIDTIGHGLIQPGRGFVIYPVRYKAIV--FRPFKGQVVDGVVTQVNKVGIFCDIGP 126

  Fly   380 KSAYV--------------------------RIFRNGGE-----------AQD-FALG-LKDD 403
            .|.::                          .:.||..|           |.| ||:| |.||
 Worm   127 LSCFISRHCIPPDMEFDPNSEKPCYKTNDEANVIRNDDEIRVKLIGTRVDANDIFAIGTLMDD 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31344NP_650433.1 DUF2236 100..>233 CDD:287016
rpb-7NP_491093.1 PTZ00162 24..192 CDD:240298 38/181 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.