DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and SGSM2

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_011522403.1 Gene:SGSM2 / 9905 HGNCID:29026 Length:1103 Species:Homo sapiens


Alignment Length:429 Identity:93/429 - (21%)
Similarity:140/429 - (32%) Gaps:115/429 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SEDDLGELPPMMEELSVADGLRPNP---GGPFSALTASMWPQEILAKLGGGAELASGPNDQPEYR 91
            |.|||....|...|.|     ||.|   .||.:..||.:..|.       ..|..|..:..|..|
Human   750 SVDDLEPPEPQDPEDS-----RPKPEQEAGPGTPGTAVVEQQH-------SVEFDSPDSGLPSSR 802

  Fly    92 -----------FDE---FGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEFSHNKEAAEL 142
                       .||   .||..|:..|.|.||..                         ..||..
Human   803 NYSVASGIQSSLDEGQSVGFEEEDGGGEEGSSGP-------------------------GPAAHT 842

  Fly   143 SWEHVDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDIVKASSNDQLMTSK 207
            ..|..|   |..||         |.....:....|:...|.....|..  |.|       .:...
Human   843 LREPQD---PSQEK---------PQAGELEAGEELAAVCAAAYTIELL--DTV-------ALNLH 886

  Fly   208 QIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEEENAFW 272
            :|:||:.|.......|:.||   :.|||.::....|...|:||.||...::|.||:         
Human   887 RIDKDVQRCDRNYWYFTPPN---LERLRDVMCSYVWEHLDVGYVQGMCDLLAPLLV--------- 939

  Fly   273 MMATIVEDLLPASYYSSTLLGIQ---ADQRVMHTLIANYLSSV---DESL-----RKHDIELSLI 326
               |:..|.|..|.:|..:..:.   .:...|.|..||..|.:   |..|     :..|......
Human   940 ---TLDNDQLAYSCFSHLMKRMSQNFPNGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYF 1001

  Fly   327 TLHWFLTLFANVVHMKILVRIWDWFFYEGSI-----VLFQLTLGMLKVKEQDLKHLENS------ 380
            ...|||..|...:..:.:..:|:..:....|     ||| :.|.:::...:.::  :|:      
Human  1002 CYRWFLLDFKRELLYEDVFAVWEVIWAARHISSEHFVLF-IALALVEAYREIIR--DNNMDFTDI 1063

  Fly   381 AQIFNSLSDIPGEVTDVEVLFRQALEVGGSLSQTVIDTH 419
            .:.||:|...|..|..:.:..|.....|.|.::...:.|
Human  1064 IKFFNALHVSPQNVLSITMPRRSCGLPGTSSTRYFPENH 1102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 48/229 (21%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
SGSM2XP_011522403.1 RUN 90..235 CDD:280855
PH_RUTBC 302..470 CDD:275431
TBC <885..1053 CDD:214540 42/183 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.