DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and USP6

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001291213.1 Gene:USP6 / 9098 HGNCID:12629 Length:1406 Species:Homo sapiens


Alignment Length:414 Identity:96/414 - (23%)
Similarity:155/414 - (37%) Gaps:76/414 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QEILAKLGGGAELASGPNDQ-PE-----YRFDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQ 126
            ::||.|...| ..|..|.|: ||     ...|.||. :.|.:.|..::.:...|.  .:..:..:
Human    16 KDILMKYDKG-HRAGLPEDKGPEPVGINSSIDRFGI-LHETELPPVTAREAKKIR--REMTRTSK 76

  Fly   127 WIAHLEFSHNKEAAELSWEHVDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSY 191
            |:..|.          .||    ....:.||.:.|.:|||..:|..:|..|......|.|:...|
Human    77 WMEMLG----------EWE----TYKHSSKLIDRVYKGIPMNIRGPVWSVLLNIQEIKLKNPGRY 127

  Fly   192 HDIVKASSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGV 256
             .|:|............|:.|:...|..:..|.:..|.....|..||...:...|::|||:....
Human   128 -QIMKERGKRSSEHIHHIDLDVRTTLRNHVFFRDRYGAKQRELFYILLAYSEYNPEVGYCRDLSH 191

  Fly   257 IVACLLLFMEEENAFWMMATIV---EDLLPA--SYYSSTLLGIQADQRVMHTLIANYLSSVDESL 316
            |.|..||::.||:|||.:..::   ...||.  |....|:.|:|..|.  |.        |.:|.
Human   192 ITALFLLYLPEEDAFWALVQLLASERHSLPGFHSPNGGTVQGLQDQQE--HV--------VPKSQ 246

  Fly   317 RK---HDIELSL----ITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDL 374
            .|   |..:..|    .:|...|....:.:.:.:.:|:||.:..||..||..:|...|||:::.|
Human   247 PKTMWHQDKEGLCGQCASLGCLLRNLIDGISLGLTLRLWDVYLVEGEQVLMPITSIALKVQQKRL 311

  Fly   375 KHLENS---AQIFNSLSDIPGEVTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQGHQIG 436
            ......   |::.|...|.                  .:::...:..|.|.....|...||    
Human   312 MKTSRCGLWARLRNQFFDT------------------WAMNDDTVLKHLRASTKKLTRKQG---- 354

  Fly   437 NPEAAPNLPKQQ--LARRQVRKSK 458
              :..|...::|  ||.|.|..|:
Human   355 --DLPPPAKREQGSLAPRPVPASR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 59/225 (26%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
USP6NP_001291213.1 TBC 97..312 CDD:214540 59/225 (26%)
DUF4607 <332..407 CDD:292024 12/51 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..380 10/35 (29%)
UBP12 <528..1114 CDD:227847
Peptidase_C19 533..>723 CDD:271592
Peptidase_C19 <1023..1367 CDD:271592
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1120..1231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1384..1406
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.