DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and BUB2

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_013771.1 Gene:BUB2 / 855077 SGDID:S000004659 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:294 Identity:64/294 - (21%)
Similarity:110/294 - (37%) Gaps:69/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KLRNMV-RQGIP-------HTLRAQMWMRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKD 212
            :||.:: .:|:|       ...|..:|..||  ....:.|...|..::|.......:..| |:.|
Yeast    21 QLRYLILSEGLPISEDKQQQRTRCYVWTVLS--QTSMEASTQRYLALLKLGPPSTTIYQK-IKND 82

  Fly   213 LLRILPTNACFSNPNGTGIPRLRRILRGIAW------------LFPDIGYCQGTGVIVACLLLFM 265
            ..|...|:..|.  |......|.|.|...||            ..|...|.||..|::|.||...
Yeast    83 TSRTFQTDPNFR--NRVSEDALIRCLSCFAWQTQQRRQKTRFGRIPVSTYVQGMNVLLAPLLYSC 145

  Fly   266 -EEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIELS----- 324
             .|..|:.:...:..:::| :|.:..|.|.|           |....:|.|||..|.:||     
Yeast   146 PSEPMAYQLFTKLCYEMIP-TYLTKNLNGAQ-----------NGAKLLDISLRIIDPKLSKFLSD 198

  Fly   325 -LITLHWF-----LTLFANVVHMKILVRIWDWFFYEG--SIVLFQLTLGMLKVKEQDLKHLENSA 381
             |:|...:     |||.:....:..::::||:.|..|  ..:||.:.. ::|::.:..|. ::..
Yeast   199 NLLTAEIYGMPSILTLSSCNKPLDQVIKLWDFMFAYGFHMNILFVVAF-LVKMRSKVFKS-DSPV 261

  Fly   382 QIFNSLSD----------------IPGEVTDVEV 399
            .:.....|                ||.::.|:.|
Yeast   262 NLLRQFPDFDADEIIRLGVGFIAKIPAQIYDLLV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 56/247 (23%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
BUB2NP_013771.1 COG5210 <1..304 CDD:227535 64/294 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.