DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and sgsm2

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_003200084.2 Gene:sgsm2 / 799094 ZFINID:ZDB-GENE-131119-52 Length:1056 Species:Danio rerio


Alignment Length:233 Identity:52/233 - (22%)
Similarity:95/233 - (40%) Gaps:47/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 QIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEEE---- 268
            :|:||:.|.......|::.|   :.:||.|:....|...:|||.||...::|.|::.:::|    
Zfish   846 RIDKDVQRCDRNYYYFTSSN---LEKLRNIMCSYVWEHLEIGYVQGMCDLLAPLMVILDDECLAY 907

  Fly   269 NAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSV---DESL-----RKHDIELSL 325
            :.|..:...:....|..             ..|.|..||..|.:   |..|     :..|.....
Zfish   908 SCFTQLMRRMSQNFPTG-------------GAMDTHFANMRSLIQILDSELFELMHQNGDYTHFY 959

  Fly   326 ITLHWFLTLFANVVHMKILVRIWDWFFYEGSI-----VLFQLTLGMLKVKEQDLKHLENS----- 380
            ....|||..|...:..:.:..:|:..:....|     ||| :.|.:::|....:  |:|:     
Zfish   960 FCYRWFLLDFKRELLYEDVFAVWEVIWVAPRISSKHFVLF-IALALVEVYRDII--LDNNMDFTD 1021

  Fly   381 -AQIFNSLSDIPGEVTDVEVLFRQALEVGGSLSQTVID 417
             .:.||.::    |..||:.:.|.|.|:...: ||:|:
Zfish  1022 IIKFFNEMA----ERHDVQHILRMARELVHKV-QTLIE 1054

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 39/183 (21%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
sgsm2XP_003200084.2 RUN 43..189 CDD:308412
PH_RUTBC 262..432 CDD:275431
TBC <844..1013 CDD:214540 39/185 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.