DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and Tbc1d21

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_083130.1 Gene:Tbc1d21 / 74286 MGIID:1921536 Length:336 Species:Mus musculus


Alignment Length:365 Identity:67/365 - (18%)
Similarity:124/365 - (33%) Gaps:102/365 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PEQSSNKLLSIPFVEDAQ----QRLQWIAHLEFSHNKEAAELSWEHVDVMLPRTEKLRNMVRQGI 165
            ||.|.:...|..|:.:.:    .:.:|.:.  |..|...|: |.:.:.:         |::.:|:
Mouse     6 PENSLSARRSATFILEKRNPPIDKAEWDSF--FDENGHLAK-SRDFICI---------NILERGL 58

  Fly   166 PHTLRAQMWMRLSG----------ALAKKQKSETSYHDIVKASSNDQLM----------TSKQIE 210
            ...:|.:.|..|:|          .|........:|:.:.:.....|.:          |...|.
Mouse    59 HPFVRTEAWKFLTGYYSWQSSRDERLMVDSNRRRNYNSLCQMYEKIQPLLENLHGNFTETRNNIA 123

  Fly   211 KDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLF---PDIGYCQGTGVIVACLLLFMEEEN-AF 271
            .|:.|:..     .:|.|..:...:::.:.:...:   ....|.:|...:|....|.:|.:: .|
Mouse   124 YDIQRLYD-----KDPLGNVLIDKKKLEKTLLLSYVCNTKAEYQRGFHEMVMLFQLMVEHDHETF 183

  Fly   272 WMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIELSLITL-------H 329
            |:....:                   |:..|:.:.|.  .|.::|   |:..|||||       |
Mouse   184 WLFQFFL-------------------QKTEHSCVINI--GVGKNL---DMLNSLITLLDPEFAEH 224

  Fly   330 --------------WFLTLFANVVH-MKILVRIWDWFFYEGSIVLFQLTL--GMLK-VKEQDLKH 376
                          ||...|..... ...:.|:|:..........||:.:  .||: |:||.|..
Mouse   225 LKGKGSGAVQSLFPWFCLCFQRAFKTFDDVWRLWEVLLTGKPCRNFQVLVAYSMLQMVREQALLE 289

  Fly   377 LENSAQIF---NSLSDIPGEVTDVEVLFRQALEVGGSLSQ 413
            ..:...|.   |:|.|:     |.:.|...|..|...|.|
Mouse   290 CMSGDAILMACNNLIDL-----DADELISAACVVYSELMQ 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 45/262 (17%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
Tbc1d21NP_083130.1 TBC 62..287 CDD:214540 44/253 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.