DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and tbc1d2b

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_012822167.2 Gene:tbc1d2b / 734055 XenbaseID:XB-GENE-5932742 Length:944 Species:Xenopus tropicalis


Alignment Length:433 Identity:137/433 - (31%)
Similarity:215/433 - (49%) Gaps:78/433 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DQPEY---------RFDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEFSHNKEAAE 141
            :|||:         ::|..||.:..||..|:  .||:       |:.|...:..|..:.|:|.:.
 Frog   559 EQPEHTFVKPHTVSKYDIHGFLIVPEDDEEE--EKLV-------AKVRALDLKTLSLTENQEISN 614

  Fly   142 -LSWEH-----VDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETS---YHDIVKA 197
             :.|::     |:..:..:.:|:.:||.||||..|::||...:....||.|.|.:   :..:::.
 Frog   615 VVKWDNYFASTVNREMACSPELKALVRNGIPHEHRSRMWKWFTNLHIKKLKDEAAPGYFQSLLQN 679

  Fly   198 SSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLL 262
            :...|...|||||.||:|.||.|..:::|...||.:||.:|...:|..||||||||...:.|..|
 Frog   680 ALEKQNPASKQIELDLMRTLPNNKHYTSPTSEGIQKLRNVLLAYSWRNPDIGYCQGINRLAAIAL 744

  Fly   263 LFMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIELSLIT 327
            |::::|:|||.:.||||..:|..||:.||||.|.||||...|:...|..:.....::.::.:|||
 Frog   745 LYLDQEDAFWCLVTIVEAFMPRDYYTKTLLGSQVDQRVFKDLMNEKLPRLCAHFEQYKVDYTLIT 809

  Fly   328 LHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDIPG 392
            .:|||.:|.:.|...||.||||...||||.|:|:..||:.|.||:::..|::|..||..|.    
 Frog   810 FNWFLVVFVDSVVSDILFRIWDSLLYEGSKVIFRFALGLFKYKEEEILKLQDSMSIFKYLR---- 870

  Fly   393 EVTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQGHQIGNPEAAPNLPKQQLARR----- 452
                             ..|:|::|..:..::|::  |.     ||     .|.:|:..|     
 Frog   871 -----------------YFSRTILDARKLCNIAFV--DM-----NP-----FPLRQIRNRRTYHL 906

  Fly   453 -QVRKSKSILEAFLFRGDGNEGDQLKNKNIRQTEILVDLREAI 494
             :||...|.|||  .|.|          .||:.|...:.|:.|
 Frog   907 EKVRLELSELEA--IRAD----------FIRERETNPERRDLI 937

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 90/216 (42%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
tbc1d2bXP_012822167.2 PH_TBC1D2A 34..134 CDD:269966
BAR 313..>425 CDD:416402
Smc <324..532 CDD:224117
TBC 640..857 CDD:214540 90/216 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.