DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and Tbc1d13

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_666364.1 Gene:Tbc1d13 / 70296 MGIID:2385326 Length:400 Species:Mus musculus


Alignment Length:397 Identity:81/397 - (20%)
Similarity:124/397 - (31%) Gaps:162/397 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 EKLRNMVRQGIP--HTLRAQMWMRLSGALAKKQKSETS--------YHD----------IVKAS- 198
            ||||.:...|||  ..||...|..|...|..::.|.||        |..          |.||: 
Mouse    24 EKLRELSFSGIPCEGGLRCLCWKILLNYLPLERASWTSILAKQRGLYSQFLREMIIQPGIAKANM 88

  Fly   199 ---------------------------SNDQLMTSKQIEKDLLRILPTNACF------------- 223
                                       .|:.|:   ||:||:.|:.|..:.|             
Mouse    89 GVFREDVTFEDHPLNPNPDSRWNTYFKDNEVLL---QIDKDVRRLCPDISFFQRATEYPCLLILD 150

  Fly   224 --------------------------------SNPNGTGIPR------------------LRRIL 238
                                            |:|:....|.                  :.|||
Mouse   151 PQNEFETLRKRVEQTTLKSQTVARNRSGVTNMSSPHKNSAPSALNEYEVLPNGCEAHWEVVERIL 215

  Fly   239 RGIAWLFPDIGYCQGTGVIVACL-LLFMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMH 302
            ...|.|.|.|.|.||...||..| ..|..:.|:.|.     |.....:::..|        .:|.
Mouse   216 FIYAKLNPGIAYVQGMNEIVGPLYYTFATDPNSEWK-----EHAEADTFFCFT--------NLMA 267

  Fly   303 TLIANYLSSVDES--------------LRKHDIELSL-----------ITLHWFLTLFANVVHMK 342
            .:..|::.|:|:|              |:..|:||.|           ....|...|.:....:.
Mouse   268 EIRDNFIKSLDDSQCGITYKMEKVYSTLKDKDVELYLKLQEQSIKPQFFAFRWLTLLLSQEFLLP 332

  Fly   343 ILVRIWDWFFYEGS---IVLFQLTLGMLKVKEQDLKHLENSAQI-FNSLSDIPGEVTDVEVLFRQ 403
            .::||||..|.:|:   .:|......::.::||   .||....: ...|.|.|  :|||..:.::
Mouse   333 DVIRIWDSLFADGNRFDFLLLVCCAMLILIREQ---LLEGDFTVNMRLLQDYP--ITDVCQILQK 392

  Fly   404 ALEVGGS 410
            |.|:..|
Mouse   393 AKELQDS 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 66/353 (19%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
Tbc1d13NP_666364.1 TBC 32..367 CDD:214540 66/353 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.