DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and Grtp1

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001355787.1 Gene:Grtp1 / 66790 MGIID:1914040 Length:359 Species:Mus musculus


Alignment Length:363 Identity:99/363 - (27%)
Similarity:170/363 - (46%) Gaps:45/363 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RFDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEFSHNKEAAELSWEHVDVMLPRTE 155
            |.|.:||. ..||....:..:..|...|...::.::|...|:.:..              :.::.
Mouse    16 RIDPYGFE-RPEDFDYAAYEEFFSTYLVILTKRAIKWSKLLKGNGG--------------VRKSV 65

  Fly   156 KLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTN 220
            .::..||:|||...||::||.:|||.|:..:|...||.:::..|:..|  .:.|..||.|..|.|
Mouse    66 TVKRYVRKGIPLEHRARVWMAVSGAQARMDQSPGYYHRLLEGESSSSL--DEAIRTDLNRTFPDN 128

  Fly   221 ACFSNPNGTGIPRLRRILRGIAWLF----PDIGYCQ-----------------GTGVIVACLLLF 264
            ..|..   |..|.|::.|..:...:    ||:||||                 |...|...|:|.
Mouse   129 VMFRK---TADPCLQKTLYNVLLAYGLHNPDVGYCQCCAQKPGSSAGLRSSLTGMNFIAGYLILI 190

  Fly   265 ME-EENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIELSLITL 328
            .: ||.:||::..:|..:|| .|||..:||::.||.|:..|:...|.:|...:..|.:..:|:..
Mouse   191 TKNEEESFWLLDALVGRILP-DYYSPAMLGLKTDQEVLAELVRMKLPAVAALMDGHGVLWTLLVS 254

  Fly   329 HWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDI-PG 392
            .||:.||.:::.::.::||||..|.|||.::|::.|.::|..::.:....:...|.:....| .|
Mouse   255 RWFICLFVDILPVETVLRIWDCLFNEGSKIIFRVALTLIKQHQEFILEASSIPDICDKFKQITKG 319

  Fly   393 E-VTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMA 429
            : ||:.....::.....||||.|.|...|:...|.|.|
Mouse   320 DFVTECHAFMQKIFSEPGSLSMTTITRLRKSCRAALQA 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 74/235 (31%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
Grtp1NP_001355787.1 TBC 71..301 CDD:214540 74/235 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.