DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and TBC1D15

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_006719627.1 Gene:TBC1D15 / 64786 HGNCID:25694 Length:699 Species:Homo sapiens


Alignment Length:399 Identity:83/399 - (20%)
Similarity:158/399 - (39%) Gaps:73/399 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PNDQPEYRFDEF-GFRVEEEDGPEQSSNKLLSI---PFVEDAQQRLQWIAHLEFSHNKEAAELSW 144
            |::..::..|.. |.::.:::.|.......:.:   |.|    ||.:.::..|::.|.::     
Human   281 PSEMADFLSDAIPGLKINQQEEPGFEVITRIDLGERPVV----QRREPVSLEEWTKNIDS----- 336

  Fly   145 EHVDVMLPRTEKLRNMV-RQGIPHTLRAQMWMRLSG-----------ALAKKQKSETSYHDIV-- 195
               :..:...:.::.|: |.|:.|.||.|.|..|.|           ...:|||::..:...:  
Human   337 ---EGRILNVDNMKQMIFRGGLSHALRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQW 398

  Fly   196 KASSNDQLMTSKQ-------IEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQG 253
            |:.|.:|...:.:       ||||:.|...||..:...:..|:..|..||........|:||.||
Human   399 KSISQEQEKRNSRLRDYRSLIEKDVNRTDRTNKFYEGQDNPGLILLHDILMTYCMYDFDLGYVQG 463

  Fly   254 TGVIVACLLLFMEEE-NAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLR 317
            ...:::.||..||.| :|||..|:.::.:  ...:...:.|::.....:.||:....|.....|.
Human   464 MSDLLSPLLYVMENEVDAFWCFASYMDQM--HQNFEEQMQGMKTQLIQLSTLLRLLDSGFCSYLE 526

  Fly   318 KHDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTL--GMLKVKEQD------- 373
            ..|.........|.|..|........::|:|:..:.|.....|.|.|  .:|:.::|.       
Human   527 SQDSGYLYFCFRWLLIRFKREFSFLDILRLWEVMWTELPCTNFHLLLCCAILESEKQQIMEKHYG 591

  Fly   374 ----LKHLENSAQIFNSLS---DIPGEVTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQ 431
                |||:       |.||   |:...:...|.:..|.::. ..|.|.|.:         ::..|
Human   592 FNEILKHI-------NELSMKIDVEDILCKAEAISLQMVKC-KELPQAVCE---------ILGLQ 639

  Fly   432 GHQIGNPEA 440
            |.::..|::
Human   640 GSEVTTPDS 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 57/248 (23%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
TBC1D15XP_006719627.1 DUF3548 19..227 CDD:192931
TBC 351..586 CDD:214540 57/236 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.