DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and TBC1D14

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_011511809.1 Gene:TBC1D14 / 57533 HGNCID:29246 Length:727 Species:Homo sapiens


Alignment Length:526 Identity:112/526 - (21%)
Similarity:189/526 - (35%) Gaps:170/526 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GPFSALTASMWPQEILA---------------KLGGGAELASGPND-----QPEYRFDEFGFRVE 100
            ||||    :.:.:.:||               ||.|.|.|......     |.||. |:.| |..
Human   233 GPFS----NFFARNLLARKQSARLDKHNDLGWKLFGKAPLRENAQKDSKRIQKEYE-DKAG-RPS 291

  Fly   101 EEDGPEQSSNKLL-----------------SIPF--VEDAQQRLQ----WIAHLEFSHNKEA--- 139
            :...|:|:..|.|                 ::|.  .|:||:..|    .:...:....|||   
Human   292 KPPSPKQNVRKNLDFEPLSTTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKRELKEAQRR 356

  Fly   140 ----------------AELSWEHVDVMLPRTE------KLRNMVRQGIPHTLRAQMWMRLSG--- 179
                            |.|:|.  :.:||..|      |:|::..||||.::|.::|....|   
Human   357 KKQLEERCRVEESIGNAVLTWN--NEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLAIGNEL 419

  Fly   180 -----------ALAKKQ-------KSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTNACFSNP 226
                       |.||::       .||....| ...|:.|:..:.:.|:.|:.|..| |.|....
Human   420 NITHELFDICLARAKERWRSLSTGGSEVENED-AGFSAADREASLELIKLDISRTFP-NLCIFQQ 482

  Fly   227 ----------------------------------NGTGIPRLRRILRGIAWLFPDIGYCQGTGVI 257
                                              .|.....|..||.......||:||.||...|
Human   483 VLIFVDFRVGLQKSFQKRKERESTKLQQLWSWCLGGPYHDMLHSILGAYTCYRPDVGYVQGMSFI 547

  Fly   258 VACLLLFMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSS----VDESL-- 316
            .|.|:|.::..:||...:.::......:::           ||.|.|:..|.::    .:|:|  
Human   548 AAVLILNLDTADAFIAFSNLLNKPCQMAFF-----------RVDHGLMLTYFAAFEVFFEENLPK 601

  Fly   317 -----RKHDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDLKH 376
                 :|:::...:..:.|..||::..:.:.:..||||.|..:|...||:..||:||:.|..|..
Human   602 LFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTK 666

  Fly   377 LE--NSAQIFNSL-SDIPGEVTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQGHQIGNP 438
            ::  :.||....| .|:|.|            |:..|::...:.:..::....|.|.|.......
Human   667 MDFIHMAQFLTRLPEDLPAE------------ELFASIATIQMQSRNKKWAQVLTALQKDSREME 719

  Fly   439 EAAPNL 444
            :.:|:|
Human   720 KGSPSL 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 61/279 (22%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
TBC1D14XP_011511809.1 TBC 398..664 CDD:214540 61/278 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.