DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and rabgap1l2

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_694092.1 Gene:rabgap1l2 / 565728 ZFINID:ZDB-GENE-070912-414 Length:320 Species:Danio rerio


Alignment Length:332 Identity:66/332 - (19%)
Similarity:122/332 - (36%) Gaps:98/332 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 SDIPGEVTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQGHQIGNPEAAPNLPKQQLARR 452
            |.|..::::.|:|....:|   ||.:.|:.:.:::     :.|...|..:|     |.|.:...|
Zfish    13 SHIIDQMSEEEILASLVVE---SLPKQVVPSKKQK-----LRDNQEQPEDP-----LDKYERENR 64

  Fly   453 QVRKSKSILEAFLFRGDGNEGDQLKNKNIR----------QTEILVD-LREAILKVGRHFITIEP 506
            :::::...||        .|.|.|..|.:.          |||..|| |.:.:.||.:..:..|.
Zfish    65 KLQETSLRLE--------QENDDLAQKLVTSKIALRNALDQTEDQVDELTKELSKVKQLLVVTEE 121

  Fly   507 KLAGHIQLTANYSTESHAKDHENFINVARTRKRRAKALHDFERHDDDELGFRR--NDIITIISQK 569
            :..|        ..|..::..|.|      ||...||..|.:|.:.....:::  :.:.|.:..:
Zfish   122 EKRG--------KEEEASQLKEMF------RKELDKAESDIKRSNSIIADYKQICSQLNTKLENQ 172

  Fly   570 DEHCWVGELNGLRGWFPAKFVELLDER-SKLYTSAGD-DAISE----TVTDLVRGTLAPAIKAFL 628
            .|     |.:....:..:|..|.  || |::::..|. ::.||    :..|..:.:|...:|   
Zfish   173 KE-----EADKNLAFIKSKLQEC--ERCSRIFSVDGSIESCSESEDRSAQDEAKTSLREQVK--- 227

  Fly   629 EHGMKRPTFLGGPIHPWLYIEEAATREVEKDFESVYSRLV--LCKTYRLDEDGKVLTPEELLYRC 691
                                      |:||:......::|  .||...|:....||..|      
Zfish   228 --------------------------ELEKELAQTKLQMVESKCKIQELEHQKAVLMTE------ 260

  Fly   692 VQAINQT 698
            :||...|
Zfish   261 LQAAKNT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540
SH3_SGSM3 540..592 CDD:212747 8/53 (15%)
RUN 619..773 CDD:280855 15/82 (18%)
rabgap1l2XP_694092.1 Smc <56..>265 CDD:224117 54/272 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.