DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and usp6nl

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_005164934.1 Gene:usp6nl / 561983 ZFINID:ZDB-GENE-041210-192 Length:849 Species:Danio rerio


Alignment Length:363 Identity:86/363 - (23%)
Similarity:148/363 - (40%) Gaps:72/363 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EILAKLGGGAELAS-GPNDQPEYRF----DEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQ-- 126
            |||||...|.|.|. .|.::..:..    |.|||..|.|          |....||:.|::|:  
Zfish    41 EILAKYDKGKEKAEVEPWEETNFELYKAVDRFGFLHEGE----------LVYDIVEEKQKQLEVE 95

  Fly   127 ----WIAHLEFSHNKEAAELSWEHVDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGALAKKQKS 187
                |:..|:          |||    ....::||...:.:|||..||.|:|..|.. :.|.::.
Zfish    96 RTTKWLKMLK----------SWE----KYKNSDKLVRRIYKGIPLQLRGQVWCLLLD-IPKIKEE 145

  Fly   188 ETSYHDIVKASSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQ 252
            :..:::.:|..:.......:||:.|:.|....:..|.:........|..:|...:....::||||
Zfish   146 KKDFYEKLKIRARGLSPDVRQIDLDVNRTYRNHIMFMHRYDVKQQDLFHVLTAYSVYNTEVGYCQ 210

  Fly   253 GTGVIVACLLLFMEEENAFWMMATIVEDLLPASYYSSTLLG--------IQADQRVMHTLIANYL 309
            |...|.|.||::|.||:|||.:..::      |....|:.|        :...|.....::...:
Zfish   211 GMSQITALLLIYMNEEDAFWALVKLL------SGQRHTMHGFFVPGFPKLMRFQEHHDRILQKMM 269

  Fly   310 SSVDESLRKHDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDL 374
            ..:.:.|...::..||.|:.||...|.:.....:.:||||.:..||..||..::..:||:.::.|
Zfish   270 PKLKQHLDNQEVYTSLYTMKWFFQCFLDRTPFTLTLRIWDIYILEGERVLTAMSYTILKLHKKTL 334

  Fly   375 KHLENS----------------------AQIFNSLSDI 390
            ..|...                      .|:.||:|::
Zfish   335 LKLSMEELVKFLQVTLSNDFFFEDDFVIEQLQNSMSEL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 53/221 (24%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
usp6nlXP_005164934.1 TBC 120..326 CDD:214540 51/212 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.