DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and si:ch211-266k8.4

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_687788.5 Gene:si:ch211-266k8.4 / 559362 ZFINID:ZDB-GENE-131121-469 Length:617 Species:Danio rerio


Alignment Length:545 Identity:118/545 - (21%)
Similarity:197/545 - (36%) Gaps:138/545 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ASGPN-DQPEYR-----FDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEFSHN--- 136
            :||.: ::|..|     ||||||                  .|.:...::||...| ::|:.   
Zfish    10 SSGKSCNKPRRRSSSVGFDEFGF------------------AFSKKRDKKLQQRCH-DYSYPQPN 55

  Fly   137 ----KEAAE-LSWEHVDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDIVK 196
                ||..| ||:.:....:.|:: :...:|.|||..:|.::|..|....:.:..|..:|.|...
Zfish    56 PVKVKELCEFLSYWNGSSFICRSQ-IERFIRIGIPPAIRGRVWRCLLNIDSLRATSCFNYEDCQS 119

  Fly   197 ----------------ASSNDQLMTS--------------------KQIEKDLLRILPTNACF-- 223
                            .||.|.|:.:                    |||..||.|..||:...  
Zfish   120 EIRRPLVDLGVSEYSIISSIDSLVDTENEISSGQASSPQVADLTLFKQIALDLQRSFPTHRTLMG 184

  Fly   224 SNPNG-TGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLP---A 284
            ..|.. .|..:|.|:|...|...|.|||.||...|.|.||:.:.||.|||.:..::|.  |   :
Zfish   185 DRPEAIEGQAKLFRVLSAFARYNPLIGYVQGMSYIAAVLLMILSEEEAFWALVALLEK--PKYLS 247

  Fly   285 SYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIELSLITLHWFLTLFANVVHMKILVRIWD 349
            ..:.|::..||....|.|.|:.:....:.:.|....:......:.||||||.::.....::.|||
Zfish   248 ELFDSSMKKIQHQALVFHQLLKHRKPLLFQHLETLGVSCVHFIMQWFLTLFTSLPCWDSVLAIWD 312

  Fly   350 WFFYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDIPGEVTDVEVLFRQALEVGGSLSQT 414
            .....|...:|:..|.::.:.|..:.::...|.:...|..:|.::....||.......  .|.:.
Zfish   313 LIMLHGLQAVFRTGLTIILLLESRIMNMTEEATVLPLLLRVPIDICHHRVLIPALWST--DLQEW 375

  Fly   415 VIDTHRRRHLAYLMADQGHQIGNPEAA-------------PNLPKQQLARRQ--VRKSKSILEAF 464
            .|:......|..|.:.|..:..|.|..             ...|.|:.|:::  ...|||:.   
Zfish   376 EINCMNSLVLEELDSTQDEEKANKENTKISTASFSDGQLHDEKPLQETAKKEASASSSKSVF--- 437

  Fly   465 LFRGDGNEGDQLKNKNIRQTEILVDLREAILKVGRHFITIEPKLAGHIQLT-----------ANY 518
                                       ..:|||.:|||....|.:...:.:           |..
Zfish   438 ---------------------------TRLLKVAQHFILKSGKYSSAAKSSPTKRSPAPGRLAKT 475

  Fly   519 STESHAKDHENFINVARTRKRRAKA 543
            .|.||....:  :...|:..||:::
Zfish   476 RTSSHFTQTQ--VRGRRSSSRRSQS 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 65/255 (25%)
SH3_SGSM3 540..592 CDD:212747 1/4 (25%)
RUN 619..773 CDD:280855
si:ch211-266k8.4XP_687788.5 RabGAP-TBC 166..338 CDD:278964 51/173 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.