DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and grtp1b

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001017810.1 Gene:grtp1b / 550508 ZFINID:ZDB-GENE-050417-346 Length:349 Species:Danio rerio


Alignment Length:335 Identity:91/335 - (27%)
Similarity:170/335 - (50%) Gaps:22/335 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RFDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEFSHNKEAAELSWEHVDVMLPRTE 155
            |.|::||  |:.|...:|..:|:|.......::..:|...|:.:...|              :..
Zfish    22 RVDQYGF--EKSDFNYESYEELMSDYLAVVTRRSKKWSKLLQGTGKME--------------KNL 70

  Fly   156 KLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTN 220
            |::..||:|||...|.::||..|||..:.:::...|..::|...:|..: .:.|..|:.|..|.|
Zfish    71 KVKRYVRKGIPCEHRTEIWMAFSGAQDQLERNPGYYQALLKTEQHDPKI-EEVIHADMHRTFPDN 134

  Fly   221 ACFSNPNGTGIPR-LRRILRGIAWLFPDIGYCQGTGVIVACLLLF-MEEENAFWMMATIVEDLLP 283
            ..|.:.:.:.:.: |..:|........|:|||||...|...||:. .:||.:||:|..::..:||
Zfish   135 IQFRHSSQSCLQKALFNVLLAYGHHNKDVGYCQGMNFIAGYLLIITKDEEKSFWLMVALIGRILP 199

  Fly   284 ASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIELSLITLHWFLTLFANVVHMKILVRIW 348
             .||:.|:||::.||.|:..|:.:.:.:|.:::.:||:..:|:...||:.|:.:|:.::.::|||
Zfish   200 -DYYTQTMLGLKVDQEVLGELVKSKVPAVWQTMNQHDVMWTLVVSRWFICLYVDVLPVETVLRIW 263

  Fly   349 DWFFYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDIP-GE-VTDVEVLFRQALEVGGSL 411
            |..|||||.:||::.|.:::..:..:...::..:|......|. || |.|.....::.....|.|
Zfish   264 DCLFYEGSKILFRVALTLIRHNQNLISQAKSLPEICEGFKQITRGEYVEDCHSFMQKIFMEPGGL 328

  Fly   412 SQTVIDTHRR 421
            |...|...|:
Zfish   329 STATITKLRK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 67/215 (31%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
grtp1bNP_001017810.1 TBC 76..289 CDD:214540 67/214 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.