DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and TBC1D8B

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_060222.2 Gene:TBC1D8B / 54885 HGNCID:24715 Length:1120 Species:Homo sapiens


Alignment Length:662 Identity:151/662 - (22%)
Similarity:276/662 - (41%) Gaps:132/662 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QEILAKLG---GGA---------ELA-SGPNDQPEYRFDEFGFRVEEEDGPEQSSNKLLSIPFVE 119
            ::::|||.   |.|         ||| |..:.:|...|:......:.|.....::..|:::...:
Human   378 EQLVAKLRLRCGAASTQYHDISTELAISSESTEPSDNFEVQSLTSQRECSKTVNTEALMTVFHPQ 442

  Fly   120 DAQQRLQWIAHLEFSHNK----EAAELSWEHV------DVMLPRTEKLRNMVRQGIPHTLRAQMW 174
                      :||..::|    :..|.||:.:      .|.:.||:|.|::|.:|||.|||.::|
Human   443 ----------NLETLNSKMLKEKMKEQSWKILFAECGRGVSMFRTKKTRDLVVRGIPETLRGELW 497

  Fly   175 MRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILR 239
            |..|||:.....:...|.::|:.|.....:.:::||:||.|.||.:..|.  :.|||..|||:|.
Human   498 MLFSGAVNDMATNPDYYTEVVEQSLGTCNLATEEIERDLRRSLPEHPAFQ--SDTGISALRRVLT 560

  Fly   240 GIAWLFPDIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTL 304
            ..|:..|.|||||...::.:.|||:.:||.|||::..:.|.:|| .|::..::|...||.|...|
Human   561 AYAYRNPKIGYCQAMNILTSVLLLYAKEEEAFWLLVAVCERMLP-DYFNRRIIGALVDQAVFEEL 624

  Fly   305 IANYLSSVDESLRKHDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKV 369
            |.::|..:.|.:..... .|.::|.||||||.:|:.::..|.:.|.|||:|...:.||.|.:|..
Human   625 IRDHLPQLTEHMTDMTF-FSSVSLSWFLTLFISVLPIESAVNVVDCFFYDGIKAILQLGLAILDY 688

  Fly   370 KEQDLKHLENSAQIFNSLSDIPGEVTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQGHQ 434
            ....|...::.|:...:|:.....||:.:......::.|.::|... .:|.|..:..|:.:...:
Human   689 NLDKLLTCKDDAEAVTALNRFFDNVTNKDSPLPSNVQQGSNVSDEK-TSHTRVDITDLIRESNEK 752

  Fly   435 IGNPEAAPNLPKQQLARRQVRKSKSILEAFLFRGDGNEGDQLKNKNIRQTEILVDLREAILKVGR 499
            .|      |:..:.:...:.|....:::..         ::...:|:.:. :..|::.::.::..
Human   753 YG------NIRYEDIHSMRCRNRLYVIQTL---------EETTKQNVLRV-VSQDVKLSLQELDE 801

  Fly   500 HFITIEPKLAGHIQLTANYSTESHAKDHENFINV-----ARTRKRRAKALHDFERHDDDELGFRR 559
            .::..:.:|                     |::.     ....|....:|...|::..|...||.
Human   802 LYVIFKKEL---------------------FLSCYWCLGCPVLKHHDPSLPYLEQYQIDCQQFRA 845

  Fly   560 NDIITIISQKDEHCWVGELN--GLRGWFPAKFVELLDERSKLYTSAGDDAISETVTDLVRGTLAP 622
              :..::|.     |....|  .|..|    ...||||.|....:..:  .|..:..:..|:...
Human   846 --LYHLLSP-----WAHSANKDSLALW----TFRLLDENSDCLINFKE--FSSAIDIMYNGSFTE 897

  Fly   623 AIKAFLEHGMKRPTFLGGPIHPWLYIEEAATREVEKDFESVYSRLVLCKTYRLDEDGKVLTPEEL 687
            .:|...:                |:|..|.|....||...                |..|:.|||
Human   898 KLKLLFK----------------LHIPPAYTEVKSKDASK----------------GDELSKEEL 930

  Fly   688 LYRCVQAINQTH 699
            ||     .:|.|
Human   931 LY-----FSQLH 937

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 76/213 (36%)
SH3_SGSM3 540..592 CDD:212747 10/53 (19%)
RUN 619..773 CDD:280855 16/81 (20%)
TBC1D8BNP_060222.2 PH-GRAM1_TBC1D8B 156..254 CDD:275419
PH-GRAM2_TBC1D8B 296..388 CDD:270159 3/9 (33%)
TBC 486..694 CDD:214540 75/211 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1035..1066
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.