DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and tbc1d15

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_005159143.1 Gene:tbc1d15 / 492676 ZFINID:ZDB-GENE-041111-251 Length:665 Species:Danio rerio


Alignment Length:445 Identity:92/445 - (20%)
Similarity:161/445 - (36%) Gaps:107/445 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LGGGAELASGPNDQPEYRFDEFGFRVEEEDGPEQSSNKLLS-----IPFVEDAQQR---LQWIAH 130
            |||.:::.:       |.||  .||..|.:..::.:.::..     ||.:|..||.   .:.|..
Zfish   226 LGGFSKVTN-------YLFD--AFRAPELECQQRPAEEVADVLGELIPGLEINQQEEPGFEVITR 281

  Fly   131 LEFSHNKEAAEL------SWEHVDVMLPRTEKLRNM----VRQGIPHTLRAQMWMRLSG------ 179
            |:.....|....      .|.....:..|...|.::    .:.|:.|.:|.:.|..|.|      
Zfish   282 LDLGPRPEMQRTGPVTMEEWAKYQDLEGRMTNLPHLKDAIFKGGLCHAVRKEAWKFLLGYFPWSS 346

  Fly   180 -----ALAKKQKSETSYHDIV--KASSNDQLMTSKQ-------IEKDLLRILPTNACFSNPNGTG 230
                 .|.:|:|::..:...:  |:.|.:|...:.:       ||||:.|....|..:...:..|
Zfish   347 THEERKLLQKRKTDEYFRMKLQWKSVSEEQERRNSRLRDYRSLIEKDVNRTDRNNKFYEGLDNPG 411

  Fly   231 IPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEEE-NAFWMMATIVEDLLPASYYSSTLLGI 294
            :..|..||........|:||.||...:::.:|..||.| :|||...:.::::  ...:...:.|:
Zfish   412 LILLHDILMTYCMYDFDLGYVQGMSDLLSPILFVMENEVDAFWCFVSFMDEM--HENFEEQMQGM 474

  Fly   295 QADQRVMHTLIA-------NYLSSVDESLRKHDIELSLITLHWFLTLFANVVHMKILVRIWDWFF 352
            :.....:.||:.       |||.:.|..       .......|.|..|...:|.:.::|:|:..:
Zfish   475 KTQLIQLSTLLRLLDLAFWNYLEAQDSG-------YLYFCFRWLLIRFKRELHFQDVLRLWEVMW 532

  Fly   353 YEGSIVLFQL-----TLGMLKVKEQD--------LKHL----------------ENSAQIFNSLS 388
            .......|.|     .|...|.|..|        |||:                |:......|..
Zfish   533 TRLPCQNFHLLVCCAILDSEKQKIMDRKYGFNEILKHINELSMKLDIEEILSKSESICMQIKSCK 597

  Fly   389 DIPGEVTDVEVLF-----RQALEVG--GSLSQ---TVIDTHRRRHLAYLMADQGH 433
            |:|..|:::..|.     ..|||..  |.|..   :...:||:.|    :...||
Zfish   598 DLPHSVSEILGLNTVSEPSAALETSEYGILESPQTSPRSSHRQDH----VVSNGH 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 53/254 (21%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
tbc1d15XP_005159143.1 DUF3548 4..220 CDD:192931
TBC 322..557 CDD:214540 52/243 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.