DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and tbc1d16

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001006076.2 Gene:tbc1d16 / 450056 ZFINID:ZDB-GENE-041010-179 Length:717 Species:Danio rerio


Alignment Length:358 Identity:82/358 - (22%)
Similarity:138/358 - (38%) Gaps:86/358 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RVEEEDGPEQSSNKLLSIPFVE-DAQQRL-------QWIAHLEFSHNKEAAELSWEHVDVMLPRT 154
            :|.:|....|.|.:..::|..| ..::||       .|:.||     ..:.::..|:        
Zfish   308 QVSDEKSCMQFSIRRPTLPSAEMHPEERLYRRLDVSSWLRHL-----NNSGQVLEEY-------- 359

  Fly   155 EKLRNMV-RQGIPHTLRAQMWMRLSGALAKKQKSET----------SYHDI------VKASSNDQ 202
             |||..: ..||..::|.::|..|....:....||.          .|.||      :....:.:
Zfish   360 -KLRKAIFFGGIDPSIRGEVWPFLLHYYSYDSTSEEREAWRLQKRGEYQDIQQRRLSMSPEEHSE 423

  Fly   203 LMTSKQ--IEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLL-F 264
            .....|  ::||::|...:|..|...|...:..:||||...|...||:|||||...:||.||. .
Zfish   424 FWRKVQFTVDKDVVRTDRSNMFFRGENNPNVEIMRRILLNYAVFNPDMGYCQGMSDLVAPLLTEI 488

  Fly   265 MEEENAFWMMATIVEDLLPASYYSS--------TLLGIQADQRVMHTLIANYLSSVDESLRKHDI 321
            .:|.:.||....::|:.:   :.||        .|:.::...|:|......:|:.:.|.      
Zfish   489 QDESDTFWCFVGLMENTI---FISSPRDEDMERQLMYLRELLRLMLPRFHQHLTRLGED------ 544

  Fly   322 ELSLITLH-WFLTLFANVVHMKILVRIWD--WFFYE----------GSIVLF--QLTLGMLKVKE 371
            .|.|:..| |.|..|.........:|:|:  |..|:          ..|||:  .:|...| ..:
Zfish   545 GLQLLFCHRWVLLCFKREFPDAEALRMWEACWAHYQTDYFHLFLCVAIIVLYGDDVTEQQL-ATD 608

  Fly   372 QDLKHLENSAQIFNSLSDIPGEVTDVEVLFRQA 404
            |.|.|..|.:...|.           |::.|:|
Zfish   609 QMLLHFSNLSMHMNG-----------ELVLRKA 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 60/256 (23%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
tbc1d16NP_001006076.2 TBC 368..596 CDD:214540 56/236 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.