DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and CG5916

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster


Alignment Length:322 Identity:89/322 - (27%)
Similarity:154/322 - (47%) Gaps:28/322 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEFSHNKEAAELSWEHVDVMLPRTEKL 157
            ||:||: ..:.....:.:|.:........::|::|.|.|:  .|.:..:     ||.      ||
  Fly    13 DEYGFK-RGDHFDYNNYSKFMDGYLKTLTRRRMKWEAILQ--QNTDLTQ-----VDA------KL 63

  Fly   158 RNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTNAC 222
            :..:|:|||...|..:||::|||.|.:::|...:.::::....|:.: |..|..||.|..|.|..
  Fly    64 KRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEI-SDSISIDLPRTFPDNIH 127

  Fly   223 FSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFM-EEENAFWMMATIVEDLLPASY 286
            |....    .||..||...|....|:|||||...|...||:.. :||.:||::..|||:::| .|
  Fly   128 FDMKK----QRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVP-QY 187

  Fly   287 YSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIELSLITLHWFLTLFANVVHMKILVRIWDWF 351
            :|..:..:..|..|...|:...:.:|:..:....:...:|...||:.:||.|:.::.::||||..
  Fly   188 HSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCV 252

  Fly   352 FYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDI---PGEVTD----VEVLFRQALE 406
            |.||..::|:..|.|....:..:...::.|.:.|...|.   ...|||    ||.:|...|:
  Fly   253 FAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSLRLK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 65/214 (30%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
CG5916NP_001287357.1 TBC 67..276 CDD:214540 65/214 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456634
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.