DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and wkd

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster


Alignment Length:332 Identity:83/332 - (25%)
Similarity:148/332 - (44%) Gaps:49/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DEFGF--RVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEFSHNKEAAELSWEHVDVMLPRTE 155
            |..||  ..:..|.|::..:|...|     |::: :|:..::          :|.  ..|....:
  Fly    22 DRNGFYGGFQRTDKPKEPLSKAQII-----AREK-KWLYMID----------NWS--IYMSKNYK 68

  Fly   156 KLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTN 220
            |:|:..|:|||.::|.:.|..||||...|:|:...|:::::...|.  .|.::|:||..|..|.:
  Fly    69 KIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNP--TTIEEIKKDKHRQFPFH 131

  Fly   221 ACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLPAS 285
            ..|.:....|...|..:|:..:...|.:|:||....|.|.||:.:..|:|||:..::. |:....
  Fly   132 EMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVC-DVYLQD 195

  Fly   286 YYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIELSLITLHWFLTLFANVVHMKILVRIWDW 350
            |:...|..||.|..::..|:......|...|:||.:|..|....|||......:..:.|:|:||.
  Fly   196 YFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDC 260

  Fly   351 FFYEGSIVLFQL-----------------------TLGMLKVKEQDLKHLENSAQIFNSLSDIPG 392
            |..||..|:|::                       ||.:|:..|:   |:.....|.|::..:..
  Fly   261 FLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEE---HIVEEEFIINNMMRLNL 322

  Fly   393 EVTDVEV 399
            .|.|.::
  Fly   323 RVEDFQI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 65/236 (28%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 47/165 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456629
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.