DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and CG42795

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001287272.1 Gene:CG42795 / 41252 FlyBaseID:FBgn0261928 Length:3213 Species:Drosophila melanogaster


Alignment Length:394 Identity:95/394 - (24%)
Similarity:172/394 - (43%) Gaps:69/394 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 WEHVDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGALAKK------QKSETSYHDIVKASSNDQ 202
            |.|...::.|       :..|.|...|.::|:.|:....|.      |:.|..:   .:....|.
  Fly   208 WLHAMKLVAR-------LPGGTPPEFRRKLWLSLADKYLKSKNVDWAQQREKCF---CEEWREDD 262

  Fly   203 LMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFM-- 265
            .....||.|||.| ..:|.|..........:|:|||.|.|...|::|||||..::.|.:|..|  
  Fly   263 EELGIQIVKDLHR-TGSNLCTGPAGSINQAKLKRILLGYARYNPEVGYCQGFNMLGALILQVMDK 326

  Fly   266 EEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRK--HDIE------ 322
            |||.:..:|..:||.:||..|:..::.|:|||..|...|:...|..:.:.|::  ..:|      
  Fly   327 EEEESMKVMIYLVEGVLPTGYFYGSMGGLQADMGVFRELMQTRLPRLAKHLQRLQGPVENAFEPP 391

  Fly   323 -LSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNS 386
             .::.|:.||||:|...:.|..::|:||....|||.||.:..|.:..:.|:.:..:.::.:.:..
  Fly   392 LTNVFTMQWFLTMFCTCLPMSCVLRVWDLVLIEGSDVLLRTALVLWSLLEERVISVRSADEFYGK 456

  Fly   387 LSD-----IPGEVTDVEVLFRQALEVG--GSLSQTVIDTHRRRHL---AYLMADQGHQIGNPEAA 441
            :..     :.|.:.|...|..:.:::|  ..|.|.     |.:||   |.|...||.|:...|..
  Fly   457 MGSYSSELLNGHLVDSNGLIERVVKLGPIEDLRQL-----RDKHLYNIAPLRHKQGLQLYYDEED 516

  Fly   442 PNLPKQQLA---------------------RRQV-RKSKSILEAFLFRGDGNEGDQLKNKNIRQT 484
            .:..:::||                     ::|| :|.:..|:..|.:   .:.|:|:.:. :|.
  Fly   517 THSDEERLAVATVFGLNWGRRGSVGPAAAGKQQVEQKDRLALDISLLK---KQYDRLRERQ-KQA 577

  Fly   485 EILV 488
            .:::
  Fly   578 HVIL 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 67/230 (29%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
CG42795NP_001287272.1 RabGAP-TBC 268..443 CDD:278964 58/175 (33%)
DUF4682 560..684 CDD:292361 4/26 (15%)
DBP 1112..1415 CDD:289157
SWIRM-assoc_2 <2376..2482 CDD:293105
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456600
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.