DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and grtp1a

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_998567.1 Gene:grtp1a / 406711 ZFINID:ZDB-GENE-040426-2733 Length:356 Species:Danio rerio


Alignment Length:370 Identity:93/370 - (25%)
Similarity:172/370 - (46%) Gaps:41/370 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 SGPNDQPEYRF-------------DEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEF 133
            :|...||::|.             |.:||: ..:|...::..:|:|.......::.::|...|: 
Zfish     7 TGRTGQPQHRINQPSTARERANSVDAYGFQ-RSDDFDYETHEQLMSEYLAVLTRRSIRWAKLLQ- 69

  Fly   134 SHNKEAAELSWEHVDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDIVKAS 198
                     ....||    |..|::..||:|:|:..|..:||..|||..:..::...|..::...
Zfish    70 ---------GRRRVD----RNLKVKRYVRKGVPNEHRPLVWMVCSGAQEQMDRNPGYYQSLLDTH 121

  Fly   199 SNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLF----PDIGYCQGTGVIVA 259
            ...:|  .:.|..||.|..|.|..|..   :..|.|::.|..:...:    ..:|||||...|..
Zfish   122 HEPKL--EESIRTDLHRTFPDNIYFRK---SAEPCLQQALYNVLVAYGHHNKAVGYCQGMNFIAG 181

  Fly   260 CLLLF-MEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIEL 323
            .|:|. .:||.:||:|..::..:|| .||:..:||::.||.|:..|:.....:|.:.::...:..
Zfish   182 YLILVSKDEETSFWLMEALLSRILP-DYYTPAMLGLKTDQEVLGELVRLKAPAVWKLMQDQGVMW 245

  Fly   324 SLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNSLS 388
            :|:...||:.||.:|:.::.::||||..|||||.:||::.|.:::..:|::...:|...:.....
Zfish   246 TLVVSRWFICLFIDVLPVETVLRIWDCLFYEGSKILFRVALTLIRHHQQEIAEAQNLPDVCERFK 310

  Fly   389 DIP--GEVTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQ 431
            .|.  ..|.|.....::..:..||||...:...|....|.::||:
Zfish   311 RITRGAFVEDCHTFMQKIFQEPGSLSMATVSKLRESCRARIIADE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 65/218 (30%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
grtp1aNP_998567.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 4/21 (19%)
TBC 84..296 CDD:214540 65/217 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.