DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and Grtp1

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001163948.1 Gene:Grtp1 / 361180 RGDID:1309210 Length:342 Species:Rattus norvegicus


Alignment Length:346 Identity:97/346 - (28%)
Similarity:168/346 - (48%) Gaps:28/346 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RFDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEFSHNKEAAELSWEHVDVMLPRTE 155
            |.|.:||. ..||....:..:..|...|...::.::|...|:.|..              :.::.
  Rat    16 RIDPYGFE-RPEDFDYAAYEEFFSTYLVILTKRAIKWSKLLKGSGG--------------VRKSV 65

  Fly   156 KLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTN 220
            .::..||:|||...||::||.:|||.|:..::...||.:::..|:.:|  .:.|..||.|..|.|
  Rat    66 TVKRYVRKGIPLEHRARVWMAVSGAQAQMDQNPGYYHRLLEGESSSRL--EEAIRTDLNRTFPDN 128

  Fly   221 ACFSNPNGTGIPRLRRILRGIAWLF----PDIGYCQGTGVIVACLLLFME-EENAFWMMATIVED 280
            ..|..   |..|.|::.|..:...:    .|:|||||...|...|:|..: ||.:||::..:|..
  Rat   129 VMFRK---TADPCLQKTLYNVLLAYGLHNQDVGYCQGMNFIAGYLILITKNEEESFWLLDALVGR 190

  Fly   281 LLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIELSLITLHWFLTLFANVVHMKILV 345
            :|| .|||..:||::.||.|:..|:...|.:|...:..|.:..:|:...||:.||.:::.::.::
  Rat   191 ILP-DYYSPAMLGLKTDQEVLAELVRMKLPAVAALMDGHGVLWTLLVSRWFICLFVDILPVETVL 254

  Fly   346 RIWDWFFYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDI-PGE-VTDVEVLFRQALEVG 408
            ||||..|.|||.::|::.|.::|..::.:....:...|.:....| .|: ||:.....::.....
  Rat   255 RIWDCLFNEGSKIIFRVALTLIKQHQEFILEASSVPDICDKFKQITKGDFVTECHTFMQKIFSEP 319

  Fly   409 GSLSQTVIDTHRRRHLAYLMA 429
            ||||...|...|....|.|.|
  Rat   320 GSLSMATITRLRESCRAALQA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 72/218 (33%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
Grtp1NP_001163948.1 TBC 71..284 CDD:214540 72/218 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.