DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and Tbc1d10a

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001015022.1 Gene:Tbc1d10a / 360968 RGDID:1311641 Length:505 Species:Rattus norvegicus


Alignment Length:397 Identity:107/397 - (26%)
Similarity:179/397 - (45%) Gaps:38/397 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MEELSVADGLR-PNPGGPFSALTASM--WPQ----EILAKLGGGAELASGPNDQPEYRFDEFGFR 98
            |.:.|..:|.| |..||..|....|:  .|.    :.|:.||..:|    .|...|.|.|:|||.
  Rat     1 MAKSSRENGPRAPASGGSLSGTRESLAQGPDAATADELSSLGSDSE----ANGFAERRIDKFGFI 61

  Fly    99 VEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEFSHNKEAAELSWEHVDVMLPRTEKLRNMVRQ 163
            |    |.:.:...|..:|.....|:..:|:..|.          :|:  ..|..:.:|:|...::
  Rat    62 V----GSQGAEGALEEVPLEVLRQRESKWLDMLN----------NWD--KWMAKKHKKIRLRCQK 110

  Fly   164 GIPHTLRAQMWMRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTNACFSNPNG 228
            |||.:||.:.|..|||...|.|::...:.::..:..:.:.:  ..||:||.|..|.:..|.:..|
  Rat   111 GIPPSLRGRAWQYLSGGKVKLQQNPGKFDELDMSPGDPKWL--DVIERDLHRQFPFHEMFVSRGG 173

  Fly   229 TGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLPASYYSSTLLG 293
            .|...|.|:|:......|:.||||....|.|.||:.|..|.|||.:..:.|..|| .|||..|..
  Rat   174 HGQQDLFRVLKAYTLYRPEEGYCQAQAPIAAVLLMHMPAEQAFWCLVQVCEKYLP-GYYSEKLEA 237

  Fly   294 IQADQRVMHTLIANYLSSVDESLRKHDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIV 358
            ||.|..::.:|:........:.|.:..|:..|....||:..||..:....::|:||.||.||..:
  Rat   238 IQLDGEILFSLLQKVSPVAHKHLSRQKIDPLLYMTEWFMCAFARTLPWSSVLRVWDMFFCEGVKI 302

  Fly   359 LFQLTLGMLK---VKEQDLKHLENSAQIFNSLSDIPGEVTDVEVLFRQALEVGGSLSQTVIDTHR 420
            :|::.|.:||   ...:.|:..:...:....|..:..::.....|.::.:|:  .:::..|:   
  Rat   303 IFRVGLVLLKHALGSPEKLRACQGQYETIEQLRSLSPKIMQEAFLVQEVIEL--PVTERQIE--- 362

  Fly   421 RRHLAYL 427
            |.||..|
  Rat   363 REHLIQL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 66/216 (31%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
Tbc1d10aNP_001015022.1 TBC 110..313 CDD:214540 65/205 (32%)
VCX_VCY 404..>501 CDD:291884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.