DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and TBC1D26

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001375394.1 Gene:TBC1D26 / 353149 HGNCID:28745 Length:468 Species:Homo sapiens


Alignment Length:269 Identity:64/269 - (23%)
Similarity:110/269 - (40%) Gaps:30/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QQRLQWIAHLEFSHNKEAAELS--WEHVDVMLP------RTEKLRNMVRQGIPHTLRAQMWMRLS 178
            :..|..::.||....::.::.:  |:.   ||.      .|:||...|.:.||..:|.:.|..|.
Human    54 EMELPHVSALEVKQRRKESKRTNKWQK---MLADWTKYRSTKKLSQRVYKVIPLAVRGRAWSLLL 115

  Fly   179 GALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAW 243
            .....|.::...| .::|............|:.|:...|..:..|....|.....|..||...:.
Human   116 DIDRIKSQNPGKY-KVMKEKGKRSSRIIHCIQLDVSHTLQKHMMFIQRFGVKQQELCDILVAYSA 179

  Fly   244 LFPDIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLPASYYSSTLLGIQA----DQRVMHTL 304
            ..|::||.:....|.|.|||.:.||:|||.:..::     |.:||.....::.    .::|:|..
Human   180 YNPEVGYHRDLSRITAILLLCLPEEDAFWALTQLL-----AVFYSPNTAWLERLLSHQEQVLHKS 239

  Fly   305 IANYLSSV-DESLRKHDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLK 368
            ....:..: .|.|   .||.|::|.  .|..|.:.....:.:|:||.|..||:.||..:.....|
Human   240 FPKIMRHLGKEGL---CIEGSMLTR--LLRCFLDGKSFGLTLRLWDVFILEGARVLTAMVHASFK 299

  Fly   369 VKEQDLKHL 377
            :..   |||
Human   300 IHR---KHL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 52/218 (24%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
TBC1D26NP_001375394.1 TBC 98..306 CDD:214540 55/222 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.