DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and Tbc1d15-17

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster


Alignment Length:472 Identity:95/472 - (20%)
Similarity:175/472 - (37%) Gaps:109/472 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EGYVGREEHTRKLQNLGSEDDLGE-----------LPPMMEEL--SVADGLRP--------NPGG 56
            |.|.......:||:...:|.|:|:           ||..:..:  ::.|.::|        .||.
  Fly   207 EVYAILTTENQKLKKTFAELDIGQIKASQLPRESWLPNKLAGILGNIPDYVQPPFQRSPKSRPGV 271

  Fly    57 PFSALTASMWPQEILAKLGGGAELASGPNDQPEYRFDEFGFRVEEEDGPEQSSNKLLS------I 115
            ..|....:......:..|.|....|...|.|..      |...|:  .|..|..:.|:      :
  Fly   272 LISGDRQTSPDNYQIIGLSGSTNSACSSNGQSR------GGSAEK--SPADSELETLNAQDEKIV 328

  Fly   116 PFVEDAQQRLQWIAHLEFSHN-KEAAELSWEHVDVMLPRTEKLRNMV-RQGIPHTLRAQMWMRLS 178
            ..:.|.|:       :|..|. .|...|.::..|..:..:.:::.:: |.|:..:||.::|..|.
  Fly   329 NNLPDRQR-------VERGHPLTETQWLEFQTPDGRISDSARIKELIFRGGVVQSLRPEVWKFLL 386

  Fly   179 GAL-----------AKKQKSETSYHDIVKASSNDQLMTSK-----------QIEKDLLRI---LP 218
            ...           .:||||...|:  :||.......|.:           |||||:.|.   |.
  Fly   387 NYYLWSDTHVERIERRKQKSIEYYN--MKAQWLAMTTTQEANFCGYRERKCQIEKDVKRTDRSLQ 449

  Fly   219 TNACFSNPNGTGIPRLRRILRGIAWLFP----DIGYCQGTGVIVACLL-LFMEEENAFWMMATIV 278
            ..|...|||.|       :|:||...:.    |:||.||...::|.:| :.:.|.:.||.....:
  Fly   450 FFAGEDNPNLT-------LLQGILMTYVMYNFDLGYVQGMSDLLAPILEIQVNEVDTFWCFVGFM 507

  Fly   279 EDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVD-------ESLRKHDIELSLITLHWFLTLFA 336
            |         ........||..|.|..|.....::       ..:|.||.:.......|.|..:.
  Fly   508 E---------LVFTNFDIDQAGMKTQFAQIRRLIEFANAPLFNYMRSHDSDNMYFCFRWLLVWYK 563

  Fly   337 NVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDLKHLENS----AQIFNSLSDIPGEVTDV 397
            ..::.:.::::|:..:.......|.| |..:.:.:|:.:.:.:|    .:|...::::.|.: ||
  Fly   564 RELNSEDVLKLWECLWTRLPCPNFHL-LFSVAILDQETRVIIDSQYEFTEILKHVNELSGNI-DV 626

  Fly   398 EVLFRQA----LEVGGS 410
            :...:.|    |::.||
  Fly   627 QKTLQVAEGIYLQLKGS 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 55/251 (22%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 54/247 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456567
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.