DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and GstT3

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:75 Identity:18/75 - (24%)
Similarity:31/75 - (41%) Gaps:3/75 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 FMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYL---SSVDESLRKHDIELSL 325
            |.:|.|.|..:..|.::....:...:.|..:.|..::...|...|.   |.|||.|....:.|.|
  Fly    87 FKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRL 151

  Fly   326 ITLHWFLTLF 335
            ....:|.|::
  Fly   152 TCAMYFRTVW 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 18/75 (24%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 7/33 (21%)
GstA 47..243 CDD:223698 18/75 (24%)
GST_C_Theta 135..259 CDD:198292 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.