DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and Rabgap1

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001101311.1 Gene:Rabgap1 / 311911 RGDID:1304691 Length:1065 Species:Rattus norvegicus


Alignment Length:615 Identity:141/615 - (22%)
Similarity:222/615 - (36%) Gaps:175/615 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TASMWPQEILAKLGGGAELASGPNDQPEYRFDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQ 126
            |||  |...|.:.|..:.:...|   ||   |:     ||||..|    .|||            
  Rat   485 TAS--PSVRLPQSGSQSSMIPSP---PE---DD-----EEEDNDE----PLLS------------ 520

  Fly   127 WIAHLEFSH-NKEAAE---------LSWEHVDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGAL 181
                 .|.. :||.||         ||..|:::.: |.::|.::||.|:|..||.::|..|:|..
  Rat   521 -----GFGDVSKECAEKILETWGELLSKWHLNLNV-RPKQLSSLVRSGVPEALRGEVWQLLAGCH 579

  Fly   182 AKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFP 246
            ......|.....|.|.|..|..:|     :|:.|..|.:..|.:..|.|...|.:|.:..:....
  Rat   580 NNDHLVEKYRILITKESPQDSAIT-----RDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDE 639

  Fly   247 DIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDL------------LPASYYSSTLLGIQADQR 299
            :||||||...:.|.|||.|.||.||.::..|:.|.            |...:|..        :|
  Rat   640 EIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQL--------ER 696

  Fly   300 VMHTLIAN-YLSSVDESLRKHDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLT 363
            :|...|.: |...:|.||..|     :....||||||.....:.::..|.|....||..|:|.:.
  Rat   697 LMQEYIPDLYNHFLDISLEAH-----MYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVA 756

  Fly   364 LGMLKVKEQD--LKHLENSAQIFNSLSDIPGEVTDVEVLFR-QALEVGGSLSQTVIDTHRRRHLA 425
            ||:||..:.|  |...|.:.:.|.  ..:|......|...| ..|.....:||..:....:.:  
  Rat   757 LGLLKTSKDDLLLTDFEGALKFFR--VQLPKRYRSEENAKRLMELACNTKISQKKLKKFEKEY-- 817

  Fly   426 YLMADQGHQIGNP--------------------------------------------EAAPNLPK 446
            :.|.:|..|..:|                                            |.|..|.|
  Rat   818 HTMREQQAQQEDPIERFERENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNK 882

  Fly   447 QQL------------ARRQVRKSKSILEAFLFRGDGNEGDQLKNKNI-----------------R 482
            :.|            .||...:|..:.|......|..|.:..||.:|                 :
  Rat   883 ELLMTKQKLIDAEDEKRRLEEESAQLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQ 947

  Fly   483 QTEILVDLREAILKVG-----RHFITIEPKLAG--HIQLTANYSTESHAKDHEN-----FINVAR 535
            ||...|::.:...||.     |.|...|.::.|  .::..::..|:...:..:|     .:.:|:
  Rat   948 QTANKVEIEKIRQKVDDCDRCRDFFNKEGRVKGASSVKGVSDEDTDEEKETLKNQLRELELELAQ 1012

  Fly   536 TRKRRAKA---LHDFERHDDDELGFRRNDI 562
            |:.:..:|   :.|.|.|    ||...:::
  Rat  1013 TKLQLVEAECKIQDLEHH----LGLALSEV 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 67/228 (29%)
SH3_SGSM3 540..592 CDD:212747 6/26 (23%)
RUN 619..773 CDD:280855
Rabgap1NP_001101311.1 PTB_Rab6GAP 141..269 CDD:269922
DUF3694 303..433 CDD:403614
TBC 559..768 CDD:214540 67/226 (30%)
ERM 790..1016 CDD:395622 36/227 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.