DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and Sgsm2

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_006246802.1 Gene:Sgsm2 / 303304 RGDID:1306957 Length:1050 Species:Rattus norvegicus


Alignment Length:404 Identity:76/404 - (18%)
Similarity:131/404 - (32%) Gaps:123/404 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GPNDQPEYRFDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEFSHNKEAAELSWEHV 147
            ||.|             .|:..|:|........|....|:|:                .:.:|..
  Rat   712 GPQD-------------PEDSKPKQEREPGAGTPGTAAAEQQ----------------SVEFESP 747

  Fly   148 DVMLPRTEKLRN-MVRQGIPHTLRAQMWMRLSGALAKKQKSE---TSYHDIVKASSNDQ------ 202
            |..||.:   || .|..||..:|.....:......|.::.||   |:.|..:.....||      
  Rat   748 DSGLPSS---RNYSVASGIQSSLDEAQSVGFEEDGAGEEGSEEPATAAHTFLGPHDPDQEKLAPA 809

  Fly   203 -------------------------LMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIA 242
                                     .:...:|:||:.|.......|:.||   :.|||.|:....
  Rat   810 SELEGGEELTAVCAATYTIELLDTVALNLHRIDKDVQRCDRNYWYFTTPN---LERLRDIMCSYV 871

  Fly   243 WLFPDIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLPASYYSSTLLGIQ---ADQRVMHTL 304
            |...|:||.||...::|.||:.::            .|.|..|.:|..:..:.   .:...|.|.
  Rat   872 WEHLDMGYVQGMCDLLAPLLVILD------------NDQLAYSCFSHLMKRMSQNFPNGGAMDTH 924

  Fly   305 IANYLSSV---DESL-----RKHDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSI---- 357
            .||..|.:   |..|     :..|.........|||..|...:..:.:..:|:..:....|    
  Rat   925 FANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEEVFAVWEVIWAARHISSEH 989

  Fly   358 -VLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDIPGEVTDVEVLFRQALEVGGSLSQTVIDTHRR 421
             ||| :.|.:::...:.::.        |::     :.||:...|.:..|           .|..
  Rat   990 FVLF-IALALVEAYREIIRD--------NNM-----DFTDIIKFFNERAE-----------RHDA 1029

  Fly   422 RHLAYLMADQGHQI 435
            :.:..:..|..|::
  Rat  1030 QEILRIARDLVHKV 1043

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 53/263 (20%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
Sgsm2XP_006246802.1 RUN 42..189 CDD:280855
PH_RUTBC 256..424 CDD:275431
TBC <838..1006 CDD:214540 42/183 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.