DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and Tbc1d25

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001100425.1 Gene:Tbc1d25 / 302552 RGDID:1559711 Length:688 Species:Rattus norvegicus


Alignment Length:441 Identity:86/441 - (19%)
Similarity:159/441 - (36%) Gaps:133/441 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 EQSSNKLLSIPFVED-----------AQQRLQW------------IAHLEFSHNKEAAELSWEHV 147
            ::||....::||.:.           .||.|.|            ::..||.        ::.:.
  Rat   154 KRSSLTTAALPFTQSILSQVGRTLSKVQQVLSWSYGEDVKPFKPPLSDAEFH--------TYLNH 210

  Fly   148 DVMLPRTEKLR-NMVRQGIPHTLRAQMWMRL-----SGALAKKQKSETSYHDIVKASSND----- 201
            :..|.|.|:|| .:...|:..:||..:|..|     .|...:::.      |.:|..|.:     
  Rat   211 EGQLSRPEELRLRIYHGGVEPSLRKVVWRYLLNVYPDGLTGRERM------DYMKRKSREYEQLK 269

  Fly   202 ----QLMTSKQIE-------KDLLRILPTNACFSNP-NGTGIPRLRRILRGIAWLFPDIGYCQGT 254
                |.:..:.:|       ||:||....:..::.| :|..:..|..:|...|...|.:.||||.
  Rat   270 SEWAQRVNPEDLEFIRSTVLKDVLRTDRAHPYYAGPEDGPHLRALHDLLTTYAVTHPQVSYCQGM 334

  Fly   255 GVIVACLLLFMEEE-NAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRK 318
            ..:.:.:|..|:.| :||.....|:: .|.|:::        .|.|.|.|..|            
  Rat   335 SDLASPILAVMDHEGHAFVCFCGIMK-RLAANFH--------PDGRAMATKFA------------ 378

  Fly   319 HDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYE-----GSIVLFQLTLGMLKVKEQDLKHLE 378
                                 |:|:|:|..|..||:     |:..||.....:|...:::....:
  Rat   379 ---------------------HLKLLLRHADPDFYQYLQEAGADDLFFCYRWLLLELKREFAFDD 422

  Fly   379 NSAQIFNSLSDIPGEVTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQGHQIGNPEAAPN 443
            ....:..:.|.:|.:..:.||      |:.|..||              :||.|  .|:....| 
  Rat   423 ALRMLEVTWSSLPPDPPEHEV------ELVGPPSQ--------------VADTG--FGSHRGRP- 464

  Fly   444 LPKQQLARRQVRKSKSILEAFLFRGDGNEGDQLKNKNIRQTEI--LVDLRE 492
            :.::.:.|.....|.:..:|.:.....::|.....:.:||..:  |..||:
  Rat   465 VRQRHMLRPAGGGSSAFEDAVVHLATSSQGPSSGGRLLRQASLDGLQQLRD 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 49/241 (20%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
Tbc1d25NP_001100425.1 TBC 225..454 CDD:214540 57/296 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.