DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and Tbc1d17

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001099728.1 Gene:Tbc1d17 / 292886 RGDID:1309686 Length:646 Species:Rattus norvegicus


Alignment Length:404 Identity:90/404 - (22%)
Similarity:149/404 - (36%) Gaps:113/404 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LRPNPGGPFSALTASMWPQEILAKLGGGAELASGPNDQPEYRFD-----EFGFR--------VEE 101
            |:|:|.|..|                  .:|...|:|:||..|:     |.|.|        |.|
  Rat   238 LQPHPEGASS------------------PDLPPLPDDEPEPGFEVISCVELGQRPTVERAPPVTE 284

  Fly   102 ED-----GPEQSSNKLLSIPFVED---------AQQRLQWIAHLEFSHNKEAAELSWEHVDVMLP 152
            |:     |||   .:|.::|.::.         ..:|..|...|.:        ||||      .
  Rat   285 EEWNRHVGPE---GRLQNVPELKSRIFSGGLSPGLRREAWKFLLGY--------LSWE------S 332

  Fly   153 RTEKLRNMVRQGIPHTLRAQM-WMRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRI 216
            ..|:.:..||:......|.:: |..:|....::......|..:              ||:|:.|.
  Rat   333 SAEEHKAHVRKKTDEYFRMKLQWKSVSAEQERRNSLLHGYRSL--------------IERDVSRT 383

  Fly   217 LPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEEE-NAFWMMATIVED 280
            ..||..:..|...|:..|..||........|:||.||...:::.:|..::.| :|||.....:| 
  Rat   384 DRTNKFYEGPENPGLGLLNDILLTYCMYHFDLGYVQGMSDLLSPILFVVQNEVDAFWCFCGFME- 447

  Fly   281 LLPASY-YSSTLLGIQADQ-----RVMHTLIANYLSSVDESLRKHDIELSL-ITLHWFLTLFANV 338
            |:..:: .|...:..|..|     ||:...:.::|.|.|..        || ....|.|..|...
  Rat   448 LVHGNFEESQETMKRQLGQLLLLLRVLDQPLCDFLDSQDSG--------SLCFCFRWLLIWFKRE 504

  Fly   339 VHMKILVRIWD--WFFYEGSIVLFQLTLGMLKVKEQD------------LKHLENSAQIFNSLSD 389
            .....::|:|:  |....|..:...:...:|.: |:|            |||: |...:..|:.|
  Rat   505 FPFPDVLRLWEVLWTGLPGPNLHLLVACAILDM-ERDTLMLSGFGSNEILKHI-NELTMKLSVED 567

  Fly   390 IPGEVTDVEVLFRQ 403
            :   :|..|.|:||
  Rat   568 V---LTRAEALYRQ 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 49/236 (21%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
Tbc1d17NP_001099728.1 DUF3548 3..218 CDD:192931
TBC 308..543 CDD:214540 57/272 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.