DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and Sgsm1

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_017453793.1 Gene:Sgsm1 / 288743 RGDID:1308178 Length:1096 Species:Rattus norvegicus


Alignment Length:480 Identity:90/480 - (18%)
Similarity:149/480 - (31%) Gaps:177/480 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDMARS---IF---------GRDHEGYVGREEHTRKLQNLGSEDDLGELPPMMEELSVADGLRPN 53
            :|:.||   :|         |:..|....|:|..|                  |||:|.|.|.  
  Rat   742 LDVQRSLPAVFRPGDSSVEDGQSSEATTSRDEAPR------------------EELAVQDSLE-- 786

  Fly    54 PGGPFSALTASMWPQEILAKLGG---------GAELASGPNDQPEYRFDEFGFRVEEEDG----P 105
                 |.|.|:...:|.::..|.         ||.:...|.:.     |:.| |.:.||.    |
  Rat   787 -----SDLLANESLEEFMSIPGSLDVALPEKDGAMMDGWPGEA-----DKHG-RADSEDNLSEEP 840

  Fly   106 EQSS--NKLLSIPFVEDAQQRLQWIAHLEFSHNKEAAELSWEHVDVMLPRTEKLRNMVRQGIPHT 168
            |..|  ..|.|:.....|......::....:::.|..:|    ..|.|.|.||            
  Rat   841 EMESLFPALASLAVTSSANNETSPVSSSGVTYSPELLDL----YTVNLHRIEK------------ 889

  Fly   169 LRAQMWMRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPR 233
                                    |:.:...:....|:..:||                      
  Rat   890 ------------------------DVQRCDRSYWYFTAANLEK---------------------- 908

  Fly   234 LRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQ 298
            ||.|:....|...:|||.||...::|.||:.:::|              ..::...|.|..:.:|
  Rat   909 LRNIMCSYIWQHIEIGYVQGMCDLLAPLLVILDDE--------------ALAFSCFTELMKRMNQ 959

  Fly   299 RVMH-----TLIANYLSSV---DESL-----RKHDIELSLITLHWFLTLFANVVHMKILVRIWDW 350
            ...|     |..||..|.:   |..|     :..|.........|||..|...:....:..:|:.
  Rat   960 NFPHGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFSVWET 1024

  Fly   351 FFYEGSI-----VLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDIPGEVTDVEVLFRQALEVGGS 410
            .:....:     ||| :.|.:::|....:  |||:.           :.||:...|.:..|    
  Rat  1025 IWAAKHVSSAHYVLF-IALALVEVYRDII--LENNM-----------DFTDIIKFFNEMAE---- 1071

  Fly   411 LSQTVIDTHRRRHLAYLMADQGHQI 435
                   .|..:.:..|..|..|::
  Rat  1072 -------RHNAKQILQLARDLVHKV 1089

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 38/231 (16%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
Sgsm1XP_017453793.1 RUN 44..186 CDD:397055
PH_RUTBC 257..428 CDD:275431
TBC <884..1053 CDD:214540 42/243 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.