DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and tbc-11

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_508178.2 Gene:tbc-11 / 180444 WormBaseID:WBGene00018075 Length:934 Species:Caenorhabditis elegans


Alignment Length:590 Identity:134/590 - (22%)
Similarity:217/590 - (36%) Gaps:141/590 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LASGPNDQPEYRFDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHLEFSHNKEAAELSW 144
            |...|:..|.......|....:.|.|..|.:..:|....|:         |||.          |
 Worm   353 LGKSPSRMPTQLLHPTGDDESDCDEPLLSGSGKVSQECKEE---------HLEM----------W 398

  Fly   145 ----EHVDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGA--LAKKQKS-ETSYHDIVKASSNDQ 202
                |:.|....|.:|:..:|..|||..||.::|..||..  ||..|.. ...||..:     .|
 Worm   399 DQLIENWDQQSDRPQKISELVLDGIPDKLRGRVWQLLSNVRILAIDQPDLVEKYHIFL-----SQ 458

  Fly   203 LMTSKQ-IEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFME 266
            ...|:| |.:|:.|..|.:..|....|.|...|.:|.:..:....::.||||...:.|.|||.|.
 Worm   459 PCPSEQVIMRDIHRTFPAHDYFKESQGKGQQSLYKISKVYSLYDEEVSYCQGLSFLAASLLLHMP 523

  Fly   267 EENAFWMMATI-----VEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIELSLI 326
            ||.||..:..|     :.||....:.:..|...|     :..|:.:|:..:...|....||..:.
 Worm   524 EEQAFCTLVKIMFNYGLRDLFKLGFDNLHLRFFQ-----LTALLKDYIPDLSHHLEHIGIETHMY 583

  Fly   327 TLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDIP 391
            ...||||||.....::::..|.|.|..:|...:|.::|.:|...:.||..|:....:......:|
 Worm   584 ASQWFLTLFTAKFPLQMVFFILDLFLSQGMNTIFHISLALLDDAKTDLLQLDFEGTLKYFRVSLP 648

  Fly   392 GEV-TDVE--------VLFR---QALEVGGSLSQTVIDTHRRRHLAYLMADQ---GHQIG----- 436
            .:. |:..        |.||   ..|||..:..:.:.:..|......|..::   .||..     
 Worm   649 RKYRTEASTKCLIHKAVKFRLNHSKLEVYENEYKRIKELERENEDPVLRMEKEIGRHQANTLRLE 713

  Fly   437 --NPEAAPNL--PKQQLAR-----------------RQVRKSKSILEAFLFRGDGNEGDQLKNKN 480
              |.:.|..|  .|.:|.|                 |..|::..|||              :|||
 Worm   714 RENDDLAHELVTSKIELRRKLDVAEDQIETSANAIERLTRQNMDILE--------------ENKN 764

  Fly   481 I-RQTEILVDL-REAILKVGRHFITIEPKLAGHIQLTANYSTESHAKDHENFINVARTRKRRAKA 543
            : |:.|.:.:: |..:|::..:....|..||.:.:|.:.                   |.:||: 
 Worm   765 LMREYEQIKEMYRRDVLRLEENGSRAEKLLAEYKKLFSE-------------------RSKRAE- 809

  Fly   544 LHDFERHDDDELGFRRNDIITIISQKDEHCWVGELNGLRGWFPAKFVELLDERSKLY---TSAGD 605
                  ::.:....::..||..||..|: ||           || ..|....||.::   |..|.
 Worm   810 ------NEREHFEVQKKAIIARISDCDK-CW-----------PA-VCEWEKNRSPVHSASTPTGP 855

  Fly   606 DAISE 610
            |.:::
 Worm   856 DLLTK 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 63/222 (28%)
SH3_SGSM3 540..592 CDD:212747 11/51 (22%)
RUN 619..773 CDD:280855
tbc-11NP_508178.2 PH-like 11..147 CDD:388408
DUF3694 183..293 CDD:372133
TBC 419..632 CDD:214540 63/222 (28%)
Smc <697..>901 CDD:224117 42/217 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.