DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and SGSM1

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001035037.1 Gene:SGSM1 / 129049 HGNCID:29410 Length:1148 Species:Homo sapiens


Alignment Length:246 Identity:52/246 - (21%)
Similarity:92/246 - (37%) Gaps:59/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 TSYHDIVKASSNDQLMTSK----------QIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAW 243
            ||.:::...||:....:.:          :||||:.| ...|..:..|  ..:.:||.|:....|
Human   909 TSANEVSPVSSSGVTYSPELLDLYTVNLHRIEKDVQR-CDRNYWYFTP--ANLEKLRNIMCSYIW 970

  Fly   244 LFPDIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMH-----T 303
            ...:|||.||...::|.||:.:::|              ..::...|.|..:.:|...|     |
Human   971 QHIEIGYVQGMCDLLAPLLVILDDE--------------ALAFSCFTELMKRMNQNFPHGGAMDT 1021

  Fly   304 LIANYLSSV---DESL-----RKHDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSI--- 357
            ..||..|.:   |..|     :..|.........|||..|...:....:..:|:..:....:   
Human  1022 HFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFLVWETIWAAKHVSSA 1086

  Fly   358 --VLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDIPGEVTDVEVLFRQALE 406
              ||| :.|.:::|....:  |||:.           :.||:...|.:..|
Human  1087 HYVLF-IALALVEVYRDII--LENNM-----------DFTDIIKFFNEMAE 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 45/213 (21%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
SGSM1NP_001035037.1 RUN 44..188 CDD:280855
PH_RUTBC 254..425 CDD:275431
Important for interaction with RAB9A and RAB9B. /evidence=ECO:0000250|UniProtKB:Q8BPQ7 256..297
Required for interaction with RAP family members 301..350
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..411
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 700..830
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 871..894
TBC <936..1105 CDD:214540 41/188 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.