DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and TBC1D8

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_005263919.1 Gene:TBC1D8 / 11138 HGNCID:17791 Length:1162 Species:Homo sapiens


Alignment Length:414 Identity:122/414 - (29%)
Similarity:196/414 - (47%) Gaps:74/414 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GGAELASGPNDQPEYRFDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQ----RLQWIAHLEFSHN 136
            |..|:.|..|.:..          |:|..|....:.|:: .|.:...|    |:          :
Human   449 GDLEMMSSQNSEES----------EKEKSPLMHPDALVT-AFQQSGSQSPDSRM----------S 492

  Fly   137 KEAAELS-W-EHV-----DVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDI 194
            :|..::| | :|.     .|.:.||||:|.:|..|||.:||.::|:..|.|:.........|.::
Human   493 REQIKISLWNDHFVEYGRTVCMFRTEKIRKLVAMGIPESLRGRLWLLFSDAVTDLASHPGYYGNL 557

  Fly   195 VKASSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVA 259
            |:.|.....:.:::||:||.|.||.:..|.|.  |||..|||:|...|...|.|||||...::.:
Human   558 VEESLGKCCLVTEEIERDLHRSLPEHPAFQNE--TGIAALRRVLTAYAHRNPKIGYCQSMNILTS 620

  Fly   260 CLLLFMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLSSVDESLRKHDIE-L 323
            .|||:.:||.|||::..:.|.:|| .|::..::|.|.||.|...||..:|..:.|.:  :|:. |
Human   621 VLLLYTKEEEAFWLLVAVCERMLP-DYFNHRVIGAQVDQSVFEELIKGHLPELAEHM--NDLSAL 682

  Fly   324 SLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQD--------------- 373
            :.::|.||||||.:::.::..|.:.|.|||:|...:|||.|.:|:...:|               
Human   683 ASVSLSWFLTLFLSIMPLESAVNVVDCFFYDGIKAIFQLGLAVLEANAEDLCSSKDDGQALMILS 747

  Fly   374 --LKHLEN---------SAQIFNSLSDIPGEVTDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYL 427
              |.|::|         |...|.|....|..|||:..|.|.:.|..|..|...|:..|.:|...:
Human   748 RFLDHIKNEDSPGPPVGSHHAFFSDDQEPYPVTDISDLIRDSYEKFGDQSVEQIEHLRYKHRIRV 812

  Fly   428 MADQGHQIGNPEAAPNLPKQQLAR 451
            :  |||:        :..||.:.|
Human   813 L--QGHE--------DTTKQNVLR 826

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 77/231 (33%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
TBC1D8XP_005263919.1 PH-GRAM1_TBC1D8 178..276 CDD:270156
PH-GRAM2_TBC1D8 318..413 CDD:270160
TBC 527..733 CDD:214540 75/210 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.