DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12241 and TBC1D3E

DIOPT Version :9

Sequence 1:NP_650432.1 Gene:CG12241 / 41834 FlyBaseID:FBgn0038304 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_001278395.1 Gene:TBC1D3E / 102723859 HGNCID:27071 Length:549 Species:Homo sapiens


Alignment Length:435 Identity:94/435 - (21%)
Similarity:157/435 - (36%) Gaps:96/435 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LTASMWPQE---ILAKLGGGAELA----SGPNDQPEY--RFDEFGFRVEEEDGPEQSSNKLLSIP 116
            :..|.|.||   |:.|...|....    .||.....|  ..|..|. |.|.:.|..::.:...|.
Human     6 VAGSWWAQEREDIIMKYEKGHRAGLPEDKGPKPFRSYNNNVDHLGI-VHETELPPLTAREAKQIR 69

  Fly   117 FVEDAQQRLQWIAHLEFSHNKEAAELSWEHVDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGAL 181
              .:..::.:|:..|.          .||    ....:.||.:...:|:|..:|..||..|....
Human    70 --REISRKSKWVDMLG----------DWE----KYKSSRKLIDQAYKGMPMNIRGPMWSVLLNTE 118

  Fly   182 AKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFP 246
            ..|.|:...| .|:|..........::|::|:...|..:..|.:..||....|..||.......|
Human   119 EMKLKNPGRY-QIMKEKGKKSSEHIQRIDRDVSGTLRKHIFFRDRYGTKQRELLHILLAYEEYNP 182

  Fly   247 DIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLPASYYS---------STLLGIQADQRVMH 302
            ::|||:....|.|..||::.||:|||.:.    .||.:..:|         .|:.|:|..|.  |
Human   183 EVGYCRDLSHIAALFLLYLPEEDAFWALV----QLLASERHSLQGFHSPNGGTVQGLQDQQE--H 241

  Fly   303 TLIANYLSSVDESLRKHDIELSLITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGML 367
            .:..:...::....:| |:......|...:.:..:.:.:.:.:|:||.:..||...|..:|....
Human   242 VVATSQPKTMGHQDKK-DLCGQCSPLGCLIRILIDGISLGLTLRLWDVYLVEGEQALMPITRIAF 305

  Fly   368 KV--------------------------KEQD--LKHLENS-AQIFNSLSDIPGEVTDVEVLFRQ 403
            ||                          :::|  ||||..| .::.....|:|.....       
Human   306 KVQQKRLTKTSRCGPWARFCNRFVDTWARDEDTVLKHLRASMKKLTRKKGDLPPPAKP------- 363

  Fly   404 ALEVGGSLSQTVIDTHRRRHLAYLMADQGHQI---GNPEAAPNLP 445
              |.|.|.|:.|            .|.:|.:.   |:.:|.|..|
Human   364 --EQGSSASRPV------------PASRGGKTLCKGDRQAPPGPP 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12241NP_650432.1 TBC 161..375 CDD:214540 54/250 (22%)
SH3_SGSM3 540..592 CDD:212747
RUN 619..773 CDD:280855
TBC1D3ENP_001278395.1 TBC 99..312 CDD:214540 53/220 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..419 13/66 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.